| Basic Information | |
|---|---|
| Family ID | F091799 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.140 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil (8.411 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.598 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.421 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00330 | Aconitase | 88.79 |
| PF00694 | Aconitase_C | 3.74 |
| PF05635 | 23S_rRNA_IVP | 1.87 |
| PF00180 | Iso_dh | 1.87 |
| PF01583 | APS_kinase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.14 % |
| All Organisms | root | All Organisms | 44.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_01904570 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | RTADIAKGTGGYVVTTSDFGEVICEAVTEIADMRHAYHAV |
| JGI11643J12802_120164321 | 3300000890 | Soil | GYRTPDIAAGTGGYVANTAEIGELVSEAVTEVVDMRHAYHAV* |
| JGI11643J12802_121089032 | 3300000890 | Soil | LEAGYRTADIAAGGHISHTKEIGDLICEAVTEIADMRYAYHAV* |
| JGI10214J12806_114735371 | 3300000891 | Soil | ADGIGHLASTAEIGELVAEALTEIADVRHAYHAV* |
| JGI10214J12806_128740493 | 3300000891 | Soil | VLRAGYRTPDIDPEGNGHAASTSEIGELVTNALAEIADLQHAYHAV* |
| JGI1027J12803_1035881261 | 3300000955 | Soil | DIANGTGGYVANTAEIGELISEAVTEIVDMRHAYHAV* |
| soilH1_100368842 | 3300003321 | Sugarcane Root And Bulk Soil | IEHVLEAGYRTPDIAAGTGGYLASTSEIGELVCQAVTEIADMRHAYHAV* |
| Ga0062589_1011376192 | 3300004156 | Soil | EAIQFVLNDGYRTRDIASDGVGYIATTSEIGERVAEAVAEIADVRYAYHAV* |
| Ga0062595_1009261871 | 3300004479 | Soil | DIELAIEHVLEAGYRTPDIASGTGGYLATTSEIGELVCHAVTEIADMRYAYHAV* |
| Ga0062595_1024740041 | 3300004479 | Soil | HVLEAGYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0062594_1013047672 | 3300005093 | Soil | GYRTPDIAEGTGGYVVTTSEFGEMICQAVTEIADMRHAYHAV* |
| Ga0065712_103941291 | 3300005290 | Miscanthus Rhizosphere | DVLEAGYRTPDIAEGTGGYVVTTSEFGEMICQAVTEIADMRHAYHAV* |
| Ga0065705_105314051 | 3300005294 | Switchgrass Rhizosphere | RTRDIASDGVGYIATTSEIGERVAEAVAEIADVRYAYHAV* |
| Ga0070690_1015845212 | 3300005330 | Switchgrass Rhizosphere | AIEHVLEAGYRTPDIAHGTGGYVANTSEIGELVSEAVTEIADMRHAYHAV* |
| Ga0066388_1056313431 | 3300005332 | Tropical Forest Soil | DAGYRTADIAAGNHASHTAEMGELICEAVTEIADMRYAYHAV* |
| Ga0068868_1014087862 | 3300005338 | Miscanthus Rhizosphere | EAGYRTPDIAQGTGGYVVSTSDFGEVICQAVTEIADMRHAYHAV* |
| Ga0070687_1001774222 | 3300005343 | Switchgrass Rhizosphere | LAIEHVLEAGYRTPDIAAGTGGYVVTTGDFGKVICDAVTEIADMRHAYHAV* |
| Ga0070674_1003900891 | 3300005356 | Miscanthus Rhizosphere | VLEAGYRTPDIAQGTGGYVANTAEIGELVSEAVTEIVDMRHAYHAV* |
| Ga0070659_1020664081 | 3300005366 | Corn Rhizosphere | EAGYRTPDIAAGTGGYVVTTGDFGKVICDAVTEIADMRHAYHAV* |
| Ga0070667_1013244272 | 3300005367 | Switchgrass Rhizosphere | LEAGYRTPDIAAGTGGYVASTTEIGELVSEAVTEVVDMRHAYHAV* |
| Ga0070701_101048871 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYRTPDIDPEGNGHAASTSEIGELVTNALAEIADLQHAYHAV* |
| Ga0070663_1018828882 | 3300005455 | Corn Rhizosphere | LEAGYRTPDIAKSTGGYVVTTSDFAEVICEAVTEIADMRHAYHAV* |
| Ga0068867_1012156862 | 3300005459 | Miscanthus Rhizosphere | GGYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0070697_1010709312 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAGYRTSDIRTNGSSYMATTSEIGELVAEAIAEIADVRHAYHAV* |
| Ga0070695_1001534492 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EHVLEAGYRTPDIASGTGGYVATTSEIGELICQAVTEIADMRHAYHAV* |
| Ga0070695_1011306172 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYRTPDIAEGTGGWIVTTSEFGELICEAVTEIADMRHSYHAV* |
| Ga0070695_1012008201 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DAGYRTADIAAGSHVSRTAEIGELICEAVTEIADMRYAYHAV* |
| Ga0070693_1007020642 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LAINDVLEAGYRTPDIAEGTGGYVVTTSEFSEMICQAVTEIADMRHAYHAV* |
| Ga0070704_1005959762 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YRTPDIASGTGGYLATTSEIGELVCHAVTEIADMRYAYHAV* |
| Ga0068857_1009733202 | 3300005577 | Corn Rhizosphere | IQDVLEAGYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0068857_1018646841 | 3300005577 | Corn Rhizosphere | ADIAAGGHISHTTEIGDLICEAVTEIADMRYAYHAV* |
| Ga0068852_1008468631 | 3300005616 | Corn Rhizosphere | EAGYRTADIAKGTGGYVVTTSDFGKVICEAVTEIADMRHAYHAV* |
| Ga0068859_1027102101 | 3300005617 | Switchgrass Rhizosphere | IQDVLEAGYRTPDIAEGTGGYVVTTSEFGEMICQAVTEIADMRHAYHAV* |
| Ga0068864_1011433471 | 3300005618 | Switchgrass Rhizosphere | AIEHVLEAGYRTPDIASGTGGYLATTSEIGELVCEAVTEIADMRHAYHAV* |
| Ga0068851_102014812 | 3300005834 | Corn Rhizosphere | VLEAGYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0068863_1025379251 | 3300005841 | Switchgrass Rhizosphere | EAGYRTPDIAKGTGGYVVTTSEFGEVVCEAVTEIADMRHAYHAV* |
| Ga0075417_105006092 | 3300006049 | Populus Rhizosphere | IAGGGNGYIASTSEIGELICQAVSEIADMRHAYHAV* |
| Ga0079222_124304862 | 3300006755 | Agricultural Soil | GYRTADIAKGTGGYVVTTSDFGEVICEAVTEIVDMRHAYHAV* |
| Ga0075421_1004905611 | 3300006845 | Populus Rhizosphere | LAIEHVLEAGYRTPDIANGTGGYVANTAEIGELVSEAVTGIVDMRHAYHAV* |
| Ga0075420_1011380381 | 3300006853 | Populus Rhizosphere | ELAIEHVLEAGYRTPDIATGTGGYVMKTEEIGELVCQAVAEIADMRHAYHAV* |
| Ga0075419_114831722 | 3300006969 | Populus Rhizosphere | AIEHVLEAGYRTPDIAAGTGGYVMKTEEIGELVCQAVAEIADMRHAYHAV* |
| Ga0075435_1007986571 | 3300007076 | Populus Rhizosphere | RTPDIAHGTGGYVATTAEIGELVSEAVTEIVDMRHAYHAV* |
| Ga0111539_105562991 | 3300009094 | Populus Rhizosphere | TADIAAGGHVARTEEMGEMICEAVTEIADMRYAYHAV* |
| Ga0105243_107778832 | 3300009148 | Miscanthus Rhizosphere | AGTGGYVMKTEEIGELICQAVAEIADMRHAYHAV* |
| Ga0105243_120870562 | 3300009148 | Miscanthus Rhizosphere | QFVLNDGYRTRDIASDGVGYIATTSEIGECVAEAVAEIADVRYAYHAV* |
| Ga0105243_123783822 | 3300009148 | Miscanthus Rhizosphere | RDIASDGVGYVATTSEIGERVAEVVAEIADVRHAYHAV* |
| Ga0075423_102236521 | 3300009162 | Populus Rhizosphere | NGTGGYVANTAEIGELVSEAVTEIVDMRHAYHAV* |
| Ga0126315_103184461 | 3300010038 | Serpentine Soil | TPDIAKGTDGYVVTTSDFAEVICEAVAEIADMRHAYHAV* |
| Ga0126310_101929731 | 3300010044 | Serpentine Soil | TPDIAQGTGGYVVTTSEFGEMICEAVTEIADMRHAYHAV* |
| Ga0126311_100219781 | 3300010045 | Serpentine Soil | ENVLEAGYRTPDIAEGTGGYVVTTSEFGELICQAVTEVADMRHAYHAV* |
| Ga0134128_113092121 | 3300010373 | Terrestrial Soil | DIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0134128_118617032 | 3300010373 | Terrestrial Soil | LAIEHVLEAGYRTPDIAHGTGGYGATTSEIGELVSEAVTEIADMRHAYHAV* |
| Ga0105239_123421461 | 3300010375 | Corn Rhizosphere | NDVLEAGYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0134124_108749141 | 3300010397 | Terrestrial Soil | FVLNDGYRTRDIASDGVGYIATTSEIGERVAEAVAEIADVRYAYHAV* |
| Ga0134127_101035751 | 3300010399 | Terrestrial Soil | LEAGYRTPDIAKGTGGYVITTSEFGEVVCEAVTEIADMRHAYHAV* |
| Ga0134127_113780972 | 3300010399 | Terrestrial Soil | AGTGGYVMKTEEIGELVCQAVAEIADMRHAYHAV* |
| Ga0134127_131546081 | 3300010399 | Terrestrial Soil | TRDIASDGVGYIATTSEIGERVAEAVAEIADARHAYHAV* |
| Ga0134122_103376242 | 3300010400 | Terrestrial Soil | TRDIASDGVGYVATTSEIGERVAEAVAEIADVRHAYHAV* |
| Ga0134122_120833802 | 3300010400 | Terrestrial Soil | YRTADISHDGSGYLATTTEIGELVAEAVAEIADVRHAYHAV* |
| Ga0134121_119806112 | 3300010401 | Terrestrial Soil | LEAGYRTPDIAHGTGGYVATTSEIGELVSEAVTEIADMRHAYHAV* |
| Ga0137391_104693072 | 3300011270 | Vadose Zone Soil | VLGAGFRTRDIATDSISYVSTTSEIGQLVAEAVAEIADARYAYHAV* |
| Ga0150984_1228483501 | 3300012469 | Avena Fatua Rhizosphere | RTPDIANGTGGYVATTAEIGELVSEAVTEIVDMRHAYHAV* |
| Ga0157354_10104342 | 3300012517 | Unplanted Soil | PDIANGTGGYVANTSEIGEFVSEAVTEIVDMRHAYHAV* |
| Ga0157306_101741991 | 3300012912 | Soil | LVLRAGYRTPDIDPEGNGHAASTSEIGELVTNALAEIADLQHAYHAV* |
| Ga0137416_102729423 | 3300012927 | Vadose Zone Soil | LDAGYRTPDIRTDGNGYVATTSEIGELVAEAVAEIADMRHAYHAV* |
| Ga0137404_118483601 | 3300012929 | Vadose Zone Soil | DIASDGVGYVATTSEIGERVAEAVAEIADVRHAYHAV* |
| Ga0164301_101555121 | 3300012960 | Soil | HGTGGYVATTAEIGELVSEAVTEIVDMRHAYHAV* |
| Ga0164305_103530542 | 3300012989 | Soil | NDGYRTPDIAADGIGYVATTCEVGERVAEAVAEIADVRHAYHAV* |
| Ga0157374_123281561 | 3300013296 | Miscanthus Rhizosphere | AGYRTPDIANGTGGYVATTAEIGEFVSEAVTEIVDMRHAYHAV* |
| Ga0157378_113695272 | 3300013297 | Miscanthus Rhizosphere | DIEKAIENVLEAGYRTPDIAKGTGGYVVTPSDFAEVICEAIAEIADMRHAYHAV* |
| Ga0163162_115224401 | 3300013306 | Switchgrass Rhizosphere | TPNIAQGTGGYVVSTSDFGEVICQAVTEIADMRHAYHAV* |
| Ga0157377_104264682 | 3300014745 | Miscanthus Rhizosphere | EGTGGYVVTTGEFSELICQAVTEIADMRHAYHAV* |
| Ga0157379_111523332 | 3300014968 | Switchgrass Rhizosphere | YRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV* |
| Ga0173480_106435002 | 3300015200 | Soil | DIAHGTGGYVANTSEIGELVSEAVTEIADMRHAYHAV* |
| Ga0137403_112099882 | 3300015264 | Vadose Zone Soil | AIQVVLSDGYRTRDIASDGVGYVATTSEIGERVAEAVAEIADVRHAYHAV* |
| Ga0132256_1007786652 | 3300015372 | Arabidopsis Rhizosphere | GYRTPDIASGTGGYVATTAEIGEFVSEAVTEIVDMRHAYHAV* |
| Ga0132256_1014192512 | 3300015372 | Arabidopsis Rhizosphere | YRTPDIAEGTGGYVVTTSEFSEMICQAVTEIADMRHAYHAV* |
| Ga0132255_1029280701 | 3300015374 | Arabidopsis Rhizosphere | TPDIASGTGGYVATTSEIGELVCQAVTEIADMRHAYHAV* |
| Ga0136617_113105401 | 3300017789 | Polar Desert Sand | RTPDIDGGGTRYIAKTSEIGQLVCDAVDEIADMRHAYHAV |
| Ga0184619_102264463 | 3300018061 | Groundwater Sediment | TRDIIATGSGYVATTSEIGELVAEAVAEIADVRHAYHAV |
| Ga0190265_112833232 | 3300018422 | Soil | DAGYRTADIAMGGHVSRTAEIGELICEAVTEIADMRYAYHAV |
| Ga0190270_111317021 | 3300018469 | Soil | LKAGYRTPDIDGGGIRYIAATSEIGQLVCDAIAEIADRRHAYHAV |
| Ga0207684_107855122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YRTPDIDPGNTGYAATTSEIGELVAEAVAEIADMRHAYHAV |
| Ga0207681_108449962 | 3300025923 | Switchgrass Rhizosphere | IAAGTGGYVVKTDVMGEMICEAVTEIADMRHAYHAV |
| Ga0207650_105157591 | 3300025925 | Switchgrass Rhizosphere | AIEHVLEAGYRTPDIAEGTGGYVVTTSDFGEVICQAVTEIADMRHAYFAV |
| Ga0207650_110322712 | 3300025925 | Switchgrass Rhizosphere | IQHVLEAGYRTADIALGGYATSTSDMGELICEAVTEIADMRYAYHAV |
| Ga0207711_107326742 | 3300025941 | Switchgrass Rhizosphere | IAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV |
| Ga0207651_106508362 | 3300025960 | Switchgrass Rhizosphere | PDIAAGTGGYVANTAEIGELVSEAVTEVVDMRHAYHAV |
| Ga0207651_115108842 | 3300025960 | Switchgrass Rhizosphere | PDIADAGPGYLATTSEIGERVAEAVAEIADVHYAYHAV |
| Ga0207712_119057502 | 3300025961 | Switchgrass Rhizosphere | AGYRTPDIAAGTGGYVVKTDVMGEMICEAVTEIADMRHAYHAV |
| Ga0207703_101243833 | 3300026035 | Switchgrass Rhizosphere | YVLEAGYRTPDIAAGTGGYVASTTEIGELVSEAVTEVVDMRHAYHAV |
| Ga0207639_101630951 | 3300026041 | Corn Rhizosphere | GYRTPDIAHGTGGYVATTAEIGELVSEAVTEIVDMRHAYHAV |
| Ga0207639_119903071 | 3300026041 | Corn Rhizosphere | VLEAGYRTADIAAGGHVARTEEMGEMICEAVTEIADMRYAYHAV |
| Ga0207641_103812451 | 3300026088 | Switchgrass Rhizosphere | YRTPDIAEGTGGYVVTTSEFGEMICQAVTEIADMRHAYHAV |
| Ga0207648_110479621 | 3300026089 | Miscanthus Rhizosphere | TPDIAQGTGGYVVTTSEFTEMICQAVTEIADMRHAYHAV |
| Ga0207676_101447913 | 3300026095 | Switchgrass Rhizosphere | YRTPDIAAGTGGYVANTAEIGELVSEAVTEVVDMRHAYHAV |
| Ga0207674_115851372 | 3300026116 | Corn Rhizosphere | GYRTADIAAGGHISHTTEIGDLICEAVTEIADMRYAYHAV |
| Ga0207674_121817092 | 3300026116 | Corn Rhizosphere | TADIAKGTGGYVVTTSDFGKVICEAVTEIADMRHAYHAV |
| Ga0207675_1023205832 | 3300026118 | Switchgrass Rhizosphere | DIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV |
| Ga0209875_10409592 | 3300027209 | Groundwater Sand | EEAIRDVLKAGYRTPDINRGGTGYVAKTAEIGQLVCDAVAEIADMRHAYHAV |
| Ga0209974_101630651 | 3300027876 | Arabidopsis Thaliana Rhizosphere | RTPDIASGTGGYLATTSEIGELVCHAVTEIADMRYAYHAV |
| Ga0209382_113379771 | 3300027909 | Populus Rhizosphere | GYRTPDIANGTGGYVANTAEIGELVSEAVTGIVDMRHAYHAV |
| Ga0268241_100954012 | 3300030511 | Soil | GYRTPDIAEGTGGYVVTTSEFGELICQAVTEIADMRHAYHAV |
| Ga0310813_119617862 | 3300031716 | Soil | EAGYRTPDIASGTGGYLATTSEIGELVCHAVTEIADMRYAYHAV |
| Ga0307413_112014692 | 3300031824 | Rhizosphere | LEAGYRTPDIATGTGGYLASTSEIGELICQAVTEIADMRHAYHAV |
| Ga0307416_1001271061 | 3300032002 | Rhizosphere | AGYRTPDIAKGTGGYVVTTSDFAEVICEAVTEIADMRHAYHAV |
| Ga0310810_107571451 | 3300033412 | Soil | ENVLEAGYRTADIAKGTGGYVVTTSDFGEVICEAVTEIADMRHAYHAV |
| ⦗Top⦘ |