NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091782

Metagenome / Metatranscriptome Family F091782

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091782
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 40 residues
Representative Sequence KERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGRVAAG
Number of Associated Samples 95
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.67 %
% of genes near scaffold ends (potentially truncated) 92.52 %
% of genes from short scaffolds (< 2000 bps) 91.59 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.028 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.234 % of family members)
Environment Ontology (ENVO) Unclassified
(29.907 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.533 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.88%    β-sheet: 8.82%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00296Bac_luciferase 9.35
PF00583Acetyltransf_1 5.61
PF01850PIN 4.67
PF01402RHH_1 3.74
PF05726Pirin_C 3.74
PF00561Abhydrolase_1 3.74
PF00903Glyoxalase 2.80
PF13701DDE_Tnp_1_4 2.80
PF04191PEMT 2.80
PF07969Amidohydro_3 2.80
PF04140ICMT 1.87
PF12697Abhydrolase_6 1.87
PF13561adh_short_C2 1.87
PF13356Arm-DNA-bind_3 1.87
PF02823ATP-synt_DE_N 0.93
PF10431ClpB_D2-small 0.93
PF00441Acyl-CoA_dh_1 0.93
PF00753Lactamase_B 0.93
PF08352oligo_HPY 0.93
PF00691OmpA 0.93
PF02776TPP_enzyme_N 0.93
PF13551HTH_29 0.93
PF00144Beta-lactamase 0.93
PF13361UvrD_C 0.93
PF13517FG-GAP_3 0.93
PF00264Tyrosinase 0.93
PF05199GMC_oxred_C 0.93
PF01645Glu_synthase 0.93
PF13545HTH_Crp_2 0.93
PF00440TetR_N 0.93
PF02602HEM4 0.93
PF02775TPP_enzyme_C 0.93
PF00581Rhodanese 0.93
PF08028Acyl-CoA_dh_2 0.93
PF10415FumaraseC_C 0.93
PF01541GIY-YIG 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 9.35
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 3.74
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.87
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.93
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 0.93
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.93
COG1587Uroporphyrinogen-III synthaseCoenzyme transport and metabolism [H] 0.93
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.93
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.93
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.93
COG2367Beta-lactamase class ADefense mechanisms [V] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.03 %
UnclassifiedrootN/A28.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100226173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1477Open in IMG/M
3300004635|Ga0062388_101051270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300005178|Ga0066688_10931138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2534Open in IMG/M
3300005434|Ga0070709_10290207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1192Open in IMG/M
3300005529|Ga0070741_10626059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria957Open in IMG/M
3300005543|Ga0070672_100956357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300005566|Ga0066693_10030835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1693Open in IMG/M
3300005764|Ga0066903_105575423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300006791|Ga0066653_10022791All Organisms → cellular organisms → Bacteria2372Open in IMG/M
3300006794|Ga0066658_10579913All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300006796|Ga0066665_10305465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1281Open in IMG/M
3300006903|Ga0075426_11477723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium517Open in IMG/M
3300009137|Ga0066709_103660188All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009143|Ga0099792_10124985All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300009143|Ga0099792_10241886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1047Open in IMG/M
3300009156|Ga0111538_10667038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1318Open in IMG/M
3300009156|Ga0111538_13444655Not Available549Open in IMG/M
3300010045|Ga0126311_11228238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300010048|Ga0126373_11485911All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300010321|Ga0134067_10412636All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300010322|Ga0134084_10381509Not Available545Open in IMG/M
3300010325|Ga0134064_10256433Not Available649Open in IMG/M
3300010326|Ga0134065_10381372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales561Open in IMG/M
3300010361|Ga0126378_12230077Not Available625Open in IMG/M
3300010366|Ga0126379_12322168Not Available636Open in IMG/M
3300010376|Ga0126381_101782508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria889Open in IMG/M
3300010880|Ga0126350_11262927Not Available589Open in IMG/M
3300011119|Ga0105246_10873160Not Available804Open in IMG/M
3300011269|Ga0137392_10087319All Organisms → cellular organisms → Bacteria2433Open in IMG/M
3300011270|Ga0137391_11361924Not Available556Open in IMG/M
3300012096|Ga0137389_11648207Not Available537Open in IMG/M
3300012189|Ga0137388_10172826All Organisms → cellular organisms → Bacteria → Proteobacteria1931Open in IMG/M
3300012202|Ga0137363_11377958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales595Open in IMG/M
3300012208|Ga0137376_11784789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300012212|Ga0150985_100722673Not Available587Open in IMG/M
3300012212|Ga0150985_100875919All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300012212|Ga0150985_112226468Not Available1283Open in IMG/M
3300012363|Ga0137390_11452814Not Available628Open in IMG/M
3300012469|Ga0150984_103484766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300012582|Ga0137358_10717731All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300012917|Ga0137395_10273404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1192Open in IMG/M
3300012917|Ga0137395_10813230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium677Open in IMG/M
3300012923|Ga0137359_10529423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1038Open in IMG/M
3300012971|Ga0126369_10371351All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300014492|Ga0182013_10529180All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae610Open in IMG/M
3300016294|Ga0182041_11501320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300016422|Ga0182039_11362297Not Available644Open in IMG/M
3300016422|Ga0182039_11740957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300017995|Ga0187816_10244883Not Available782Open in IMG/M
3300018060|Ga0187765_10485190Not Available779Open in IMG/M
3300018088|Ga0187771_10084832All Organisms → cellular organisms → Bacteria → Proteobacteria2528Open in IMG/M
3300019786|Ga0182025_1221046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2035Open in IMG/M
3300020580|Ga0210403_11349491Not Available542Open in IMG/M
3300021401|Ga0210393_11261235Not Available594Open in IMG/M
3300021406|Ga0210386_11511279Not Available560Open in IMG/M
3300021432|Ga0210384_10974442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales749Open in IMG/M
3300021479|Ga0210410_10221267All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300025898|Ga0207692_10943076All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300025915|Ga0207693_11060269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300025936|Ga0207670_11472942All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300026316|Ga0209155_1048380All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300026490|Ga0257153_1046119All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300026508|Ga0257161_1135224Not Available518Open in IMG/M
3300026547|Ga0209156_10437845All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300027583|Ga0209527_1115652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300027663|Ga0208990_1010803All Organisms → cellular organisms → Bacteria3043Open in IMG/M
3300027905|Ga0209415_10949169All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300027965|Ga0209062_1180220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales791Open in IMG/M
3300028781|Ga0302223_10110189Not Available911Open in IMG/M
3300030730|Ga0307482_1215936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales589Open in IMG/M
3300030739|Ga0302311_10176833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1638Open in IMG/M
3300031525|Ga0302326_12723303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
3300031545|Ga0318541_10155913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00881254Open in IMG/M
3300031545|Ga0318541_10658738All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031573|Ga0310915_10885347Not Available626Open in IMG/M
3300031672|Ga0307373_10190049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1496Open in IMG/M
3300031708|Ga0310686_111021766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria640Open in IMG/M
3300031719|Ga0306917_10765016All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300031719|Ga0306917_11443845All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031724|Ga0318500_10441726Not Available650Open in IMG/M
3300031744|Ga0306918_10155763All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300031744|Ga0306918_10658257All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031770|Ga0318521_10761985Not Available589Open in IMG/M
3300031779|Ga0318566_10578016Not Available548Open in IMG/M
3300031781|Ga0318547_10713451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300031782|Ga0318552_10223381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria955Open in IMG/M
3300031795|Ga0318557_10118408Not Available1183Open in IMG/M
3300031795|Ga0318557_10353162Not Available676Open in IMG/M
3300031798|Ga0318523_10045081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2055Open in IMG/M
3300031823|Ga0307478_10107935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2165Open in IMG/M
3300031859|Ga0318527_10147851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088984Open in IMG/M
3300031880|Ga0318544_10251040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300031890|Ga0306925_10227715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2011Open in IMG/M
3300031910|Ga0306923_10350037All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300031942|Ga0310916_10796427Not Available796Open in IMG/M
3300031945|Ga0310913_10526753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium839Open in IMG/M
3300031954|Ga0306926_12950064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300032060|Ga0318505_10186831Not Available968Open in IMG/M
3300032060|Ga0318505_10368835Not Available678Open in IMG/M
3300032090|Ga0318518_10478408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300032160|Ga0311301_10834453All Organisms → cellular organisms → Bacteria → Proteobacteria1258Open in IMG/M
3300032261|Ga0306920_100357904All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300032261|Ga0306920_100683456Not Available1513Open in IMG/M
3300032770|Ga0335085_12173242All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300032955|Ga0335076_11227204Not Available634Open in IMG/M
3300033289|Ga0310914_10212716All Organisms → cellular organisms → Bacteria → Proteobacteria1729Open in IMG/M
3300033290|Ga0318519_10108561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1504Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.80%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.93%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10022617313300004152Bog Forest SoilELRDRVAEYAAVGVGHIMVHPHDRNVDDWDSVIEGVGRLAGG*
Ga0062388_10105127023300004635Bog Forest SoilGMMRDRVAAYEAAGVQHVMVHPQDREIDDWDEVIEGVGRLAAG*
Ga0066688_1093113813300005178SoilGMMKERVAAYAEAGVRHIMVHPQDREIDDWDTVLDAVGKLAAG*
Ga0070709_1029020713300005434Corn, Switchgrass And Miscanthus RhizosphereERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAAG*
Ga0070741_1062605913300005529Surface SoilERVAAYAEAGVQHIMVHPQDREVDDWDAVLEGVGKVAAG*
Ga0070672_10095635713300005543Miscanthus RhizosphereERIAAYEAAGVQHVMVHPLDREVDEWDEVIEGVGKAAAG*
Ga0066693_1003083553300005566SoilVAAYAEAGVQHIMVHPQDREIDDWDTVLDAVGKLAG*
Ga0066903_10557542323300005764Tropical Forest SoilAAYKAAGVQHVMVHPQDREVDDWDTVIEGIGRVAAG*
Ga0066653_1002279163300006791SoilERIAAYAEAGVQHIMVHPQDREIDNWDTVIEGVGKVAAG*
Ga0066658_1057991323300006794SoilMMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKVAAG*
Ga0066665_1030546513300006796SoilDVGMMRERVAAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG*
Ga0075426_1147772323300006903Populus RhizosphereGMMRERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAAG*
Ga0066709_10366018813300009137Grasslands SoilMKERVAAYAEAGVQHIMVHPQDREIDDCDTVLEGVGKLAG*
Ga0099792_1012498513300009143Vadose Zone SoilERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKLAAGR*
Ga0099792_1024188633300009143Vadose Zone SoilERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAG*
Ga0111538_1066703823300009156Populus RhizosphereMMKERVAAYEDAGVQHIMVHPQDREVDDWDTVIAGVGKVAAD*
Ga0111538_1344465523300009156Populus RhizosphereVAAYADAGVQHIMVHPQDREVDDWDTVIAGVGKVAAG*
Ga0126311_1122823813300010045Serpentine SoilERIAAYAKAGVQHVMVHPQDREVDDWDTVIEGVGKVAAG*
Ga0126373_1148591113300010048Tropical Forest SoilQGELRERLAAYEVAGVQHVMVHPLNRDIDDWDDVIEGVGRVAGRV*
Ga0134067_1041263613300010321Grasslands SoilYAEAGVQHIMVHPQDREIDDWDTVLDAVGKLTAG*
Ga0134084_1038150923300010322Grasslands SoilVAAYAEAGVQHIMVHPQDREIDDWDTVLDTVGKLAAG*
Ga0134064_1025643313300010325Grasslands SoilVAAYAEAGVQHIMVHPQDREIDDWDTVLDAVGKLTAG*
Ga0134065_1038137223300010326Grasslands SoilYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVASG*
Ga0126378_1223007723300010361Tropical Forest SoilGYANAGVQHVMVHPQDREIDDWDEVIEGVGRLAAG*
Ga0126379_1232216813300010366Tropical Forest SoilRDRIAGYANAGVQHVMVHPQDREIDDWDEVIEGVGRLAAG*
Ga0126381_10178250813300010376Tropical Forest SoilGELRDRIAAYAEAGVQHVMVHPLDRDIDDWDAVIEGTGRVAVRLS*
Ga0126350_1126292723300010880Boreal Forest SoilVAAYAAAGVQHVMVHPQDREVDEWDTVIEGVGRLVR*
Ga0105246_1087316023300011119Miscanthus RhizosphereAMMKERVAAYAEAGVQHIMVHPQDREVDDWDTVIAGVGKVAAD*
Ga0137392_1008731953300011269Vadose Zone SoilRVVAYAEAGVQHVMVHPQDREVDDWDIVIEGVGQVAAA*
Ga0137391_1136192413300011270Vadose Zone SoilVGMMKERVAAYAEAGVQHVMVHPQDREVDDWDDVIEGAGKVAAA*
Ga0137389_1164820713300012096Vadose Zone SoilKERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGRVAAG*
Ga0137388_1017282613300012189Vadose Zone SoilERVVAYAEAGVQHVMVHPQDREVDDWDIVIEGVGQVAAA*
Ga0137363_1137795823300012202Vadose Zone SoilMAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG*
Ga0137376_1178478913300012208Vadose Zone SoilAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLTTG*
Ga0150985_10072267323300012212Avena Fatua RhizosphereRVAAYREVGVQHIMVHPQDREVDDWDTVIEGVGKVAAAF*
Ga0150985_10087591923300012212Avena Fatua RhizosphereRVAAYAEAGVQHIMVHPQDREIDDWDTVLEGVGKLAG*
Ga0150985_11222646843300012212Avena Fatua RhizosphereMMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKVAAA*
Ga0137390_1145281413300012363Vadose Zone SoilVAAYAEAGVQHVMVHPQDREDDDWDTVIDGVGKVAGG*
Ga0150984_10348476623300012469Avena Fatua RhizosphereVGMMKERVAAYAEAGVQHIMVHPQDREVDDCETVIDGVGKIAIG*
Ga0137358_1071773113300012582Vadose Zone SoilAYAEAGVQHIMVHPQDREVDDWDTVIEGVGKVAAA*
Ga0137395_1027340423300012917Vadose Zone SoilYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG*
Ga0137395_1081323023300012917Vadose Zone SoilMMKERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGKLAAQ*
Ga0137359_1052942323300012923Vadose Zone SoilVGMMRERVMAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLTTG*
Ga0126369_1037135113300012971Tropical Forest SoilERVAAYAEAGVQHIMVHPQDREVDDWDTVLAAVGKLAAG*
Ga0182013_1052918013300014492BogDRVAAYAAAGVGHIMVHPHDRNVDDWDSVIEGVGRLAASGA*
Ga0182041_1150132013300016294SoilGMMRERIAAYAQAGVQHIMVHPRDREVDDWDAFIESVGRMGAA
Ga0182039_1136229723300016422SoilRERVAAYDAAGVQHVMVHPQDREIDDWDRVIEGVGRIAAG
Ga0182039_1174095713300016422SoilMLRERVSAYEAAGVQHVMVHPQDREVDDWDTVIEGVGR
Ga0187816_1024488313300017995Freshwater SedimentERVAAYAEAGVQHIMVHPQDREIDDWHTVIEGVGKVAAG
Ga0187765_1048519013300018060Tropical PeatlandRDEGELRARIAAYAEAGVQHVMVHPLDRDVDDWDAVIEGAGRVAA
Ga0187771_1008483253300018088Tropical PeatlandKERVAAYEAAGVQHVMVHPQDREVDDWETVIAGVGKLAAG
Ga0182025_122104623300019786PermafrostMMKERVAAYAEAGVQHVMVHPQDREIDDWNTVIEGVGRLL
Ga0210403_1134949123300020580SoilRERVAAYEAAGVQHVMVHPQDREIDDWDIVIEGVGKLI
Ga0210393_1126123513300021401SoilKDVGMMKERVAAYEAAGVQHVMVHPQDREVDDWDTVISGVGKLI
Ga0210386_1151127913300021406SoilVAAYAAAGVQHIMVHPQDREVDDWDTVIAGVGKLI
Ga0210384_1097444223300021432SoilRVAAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLATG
Ga0210410_1022126743300021479SoilVAAYATAGVQHVMVHPQDREIDDWDTVIEGVGKLI
Ga0207692_1094307613300025898Corn, Switchgrass And Miscanthus RhizosphereERVAAYAEAGVQHIMVHPQDREVDDWDTVLDAVGKLAAG
Ga0207693_1106026923300025915Corn, Switchgrass And Miscanthus RhizosphereMMKERVAAYAGAGVQHIMVHPQDREVDDWDTVIEGVGKLAAG
Ga0207670_1147294223300025936Switchgrass RhizosphereIAAYEAAGVQHVMVHPLDREVDEWDEVIEGVGKAAAG
Ga0209155_104838013300026316SoilKERVAAYVEAGVQHIMVHPQDREIDDWDAVLDAVGKLAG
Ga0257153_104611913300026490SoilMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKLAVA
Ga0257161_113522413300026508SoilERVAAYAEAGVQHVMVHPQDREIDDWDTVIEGVGKVAAG
Ga0209156_1043784513300026547SoilRERVAAYVEAGVQHIMVHPQDREVDDWDTVLDAVGKLAG
Ga0209527_111565223300027583Forest SoilMMKERVAAYAEAGVQHIMVHPQDREIDDWDTVIEGVGKLAAA
Ga0208990_101080353300027663Forest SoilVAAYAEAGVQHVMVHPQDREVDDWDTVIEGVGKVAAG
Ga0209415_1094916923300027905Peatlands SoilGEMRERVAAYGEAGVQHIMVHPQDREVDDWDTVIEGVGRVAAG
Ga0209062_118022023300027965Surface SoilKERVAAYAEAGVQHIMVHPQDREVDDWDAVLEGVGKVAAG
Ga0302223_1011018913300028781PalsaDRVAAYAAIGVGHIMIHPHDRNVDDWDSVIEGVGRLAGG
Ga0307482_121593623300030730Hardwood Forest SoilMMRDRVAAYKGAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG
Ga0302311_1017683323300030739PalsaRVAAYSAIGVGHIMIHPHDRNVDDWDSVIEGVGRLAGG
Ga0302326_1272330323300031525PalsaPGMMQERVAAYKEAGVQHIMVHPQDREVDDWNTVIEAVGRLAAG
Ga0318541_1015591333300031545SoilMRNRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVATA
Ga0318541_1065873813300031545SoilMRERVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVARD
Ga0310915_1088534713300031573SoilDRLAEFAAAGVQHVMVHPLNRDIDDWDEVIEGVGRVASRT
Ga0307373_1019004943300031672SoilAFAEIGVQHIMVHPQDREVDDWDTVIAGVGKLAAG
Ga0310686_11102176623300031708SoilGELRERIAAYAEAGVQHVMVHPLDRDIDDWDAVIEGTGRVAA
Ga0306917_1076501613300031719SoilAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVARD
Ga0306917_1144384513300031719SoilAAYEAVGVQHVMVHPHDREVDDWDTVIEGVGRVAAYM
Ga0318500_1044172623300031724SoilRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRLLH
Ga0306918_1015576313300031744SoilVGMMRDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVVAS
Ga0306918_1065825723300031744SoilVGMMRERVAAYAAAGVQHVMVHPQDREVDDWDTVIEGVGRLARG
Ga0318521_1076198523300031770SoilMRERVAAYDAAGVQHVMVHPQDREIDDWDRVIEGVGRIAAG
Ga0318566_1057801613300031779SoilGMMRNRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVATS
Ga0318547_1071345113300031781SoilAYEAAGVQHVMVHPQDREVDDWDEVIEGVGRLATG
Ga0318552_1022338123300031782SoilGMMRDRVAAYEAAGVQHVMVHPQDREVDDWDEVIEGVGRLATG
Ga0318557_1011840823300031795SoilDIGMMRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRLLH
Ga0318557_1035316223300031795SoilSAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG
Ga0318523_1004508143300031798SoilVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVATA
Ga0307478_1010793523300031823Hardwood Forest SoilMMRDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVATGY
Ga0318527_1014785133300031859SoilAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRIAAG
Ga0318544_1025104013300031880SoilMMRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRLANT
Ga0306925_1022771513300031890SoilGMMRERVAAYEAVGVQHVMVHPQDREIDDWDTVIEGAGRVANA
Ga0306923_1035003713300031910SoilDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVVAS
Ga0310916_1079642733300031942SoilMMRERVAAYEAAGVQHVMVHPHDREVDDWDTVIEGVGRVASG
Ga0310913_1052675313300031945SoilERVAAYEAVGVQHVMVHPQDREIDDWDTVIEGAGRVANA
Ga0306926_1295006423300031954SoilVGMMRDRIAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG
Ga0318505_1018683123300032060SoilDVGMLRERVSAYEAAGVQHVMVHPQDREVDDWDTVIEGVGRVAAG
Ga0318505_1036883523300032060SoilMRDRVAAYKAAGVQHVMVHPQDREVDDWDSVIEGVGRVATG
Ga0318518_1047840823300032090SoilGELRDRLGGYAAIGVQHVMVHPVDRDIDDWDAVIEGTGRVAARSPSLAAGRSP
Ga0311301_1083445333300032160Peatlands SoilMMKERVAAYAEAGVQHIMVHPQDREVDDWDTVIEGVGKVAAG
Ga0306920_10035790413300032261SoilARIAAYGEAGVQHVMIHPVDRNVDDWDAVIEGTGRVAN
Ga0306920_10068345613300032261SoilDVGMMRDRVAAYKAAGVQHVMVHPQDREVDDWDTVIEGVGRVVAS
Ga0335085_1217324223300032770SoilVGMMQERVAAYAEAGVQHIMVHPQDREVDDWDTVLDGVGKVSGASKM
Ga0335076_1122720423300032955SoilAAYAEAGVQHVMVHPLNRDIDDWDAVIDGAGRVAA
Ga0310914_1021271643300033289SoilELRERLAAYEVVVQHVMVHPLNRDIDDWNEVIEGLGRVAARI
Ga0318519_1010856133300033290SoilGMMRDRVAAYEAAGVQHVMVHPQDREVDDWDTVIEGVGCLAVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.