NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091762

Metagenome / Metatranscriptome Family F091762

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091762
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 215 residues
Representative Sequence LVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIA
Number of Associated Samples 91
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.52 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.047 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(34.579 % of family members)
Environment Ontology (ENVO) Unclassified
(43.925 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.860 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 43.87%    Coil/Unstructured: 31.13%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01593Amino_oxidase 0.93
PF13450NAD_binding_8 0.93
PF00188CAP 0.93
PF02674Colicin_V 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1286Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formationCell wall/membrane/envelope biogenesis [M] 0.93
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.05 %
UnclassifiedrootN/A14.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_12712866Not Available524Open in IMG/M
3300002239|JGI24034J26672_10124625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea501Open in IMG/M
3300004463|Ga0063356_106312955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea508Open in IMG/M
3300004480|Ga0062592_102359402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea533Open in IMG/M
3300005290|Ga0065712_10484244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea648Open in IMG/M
3300005334|Ga0068869_100492908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1022Open in IMG/M
3300005354|Ga0070675_100149198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2003Open in IMG/M
3300005457|Ga0070662_101410614All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea600Open in IMG/M
3300005467|Ga0070706_101797535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea557Open in IMG/M
3300005544|Ga0070686_101274330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea613Open in IMG/M
3300005617|Ga0068859_100060811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3806Open in IMG/M
3300005843|Ga0068860_101495752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea697Open in IMG/M
3300006046|Ga0066652_100362131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1309Open in IMG/M
3300006791|Ga0066653_10458822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea649Open in IMG/M
3300006844|Ga0075428_101871116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea624Open in IMG/M
3300006969|Ga0075419_10600764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea773Open in IMG/M
3300009156|Ga0111538_11475196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea858Open in IMG/M
3300009156|Ga0111538_13965915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea511Open in IMG/M
3300009553|Ga0105249_12317879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes610Open in IMG/M
3300010403|Ga0134123_12194968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea614Open in IMG/M
3300011442|Ga0137437_1297547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea551Open in IMG/M
3300012882|Ga0157304_1073398Not Available574Open in IMG/M
3300012882|Ga0157304_1107945Not Available516Open in IMG/M
3300012883|Ga0157281_1006420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1187Open in IMG/M
3300012883|Ga0157281_1020970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea829Open in IMG/M
3300012885|Ga0157287_1074230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea585Open in IMG/M
3300012891|Ga0157305_10066706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea814Open in IMG/M
3300012892|Ga0157294_10060908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea883Open in IMG/M
3300012893|Ga0157284_10266523Not Available547Open in IMG/M
3300012895|Ga0157309_10023686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1365Open in IMG/M
3300012900|Ga0157292_10112541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium826Open in IMG/M
3300012901|Ga0157288_10078224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea847Open in IMG/M
3300012903|Ga0157289_10061172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium984Open in IMG/M
3300012905|Ga0157296_10029718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1150Open in IMG/M
3300012906|Ga0157295_10246169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea596Open in IMG/M
3300012907|Ga0157283_10289992Not Available563Open in IMG/M
3300012909|Ga0157290_10218796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea658Open in IMG/M
3300012910|Ga0157308_10291864Not Available593Open in IMG/M
3300012910|Ga0157308_10315444Not Available578Open in IMG/M
3300012912|Ga0157306_10049179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1052Open in IMG/M
3300012913|Ga0157298_10034791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1066Open in IMG/M
3300012916|Ga0157310_10186231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea744Open in IMG/M
3300012985|Ga0164308_11667891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea590Open in IMG/M
3300014325|Ga0163163_13154684Not Available514Open in IMG/M
3300014326|Ga0157380_10501349All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1179Open in IMG/M
3300014326|Ga0157380_11074379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes842Open in IMG/M
3300014745|Ga0157377_10997673All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea634Open in IMG/M
3300015200|Ga0173480_10776458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea609Open in IMG/M
3300015201|Ga0173478_10009448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2477Open in IMG/M
3300015373|Ga0132257_102415195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea682Open in IMG/M
3300017792|Ga0163161_10413897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1083Open in IMG/M
3300017792|Ga0163161_11047111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea699Open in IMG/M
3300018031|Ga0184634_10250446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea812Open in IMG/M
3300018067|Ga0184611_1263957Not Available606Open in IMG/M
3300018067|Ga0184611_1271463Not Available595Open in IMG/M
3300018476|Ga0190274_10806867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium996Open in IMG/M
3300018476|Ga0190274_11680202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea729Open in IMG/M
3300018476|Ga0190274_12339088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea631Open in IMG/M
3300019356|Ga0173481_10019421All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2050Open in IMG/M
3300019356|Ga0173481_10357211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea700Open in IMG/M
3300019361|Ga0173482_10550859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea570Open in IMG/M
3300019362|Ga0173479_10614909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea571Open in IMG/M
3300019871|Ga0193702_1004250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2036Open in IMG/M
3300019997|Ga0193711_1033929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea635Open in IMG/M
3300020000|Ga0193692_1000659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8794Open in IMG/M
3300020000|Ga0193692_1103722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea597Open in IMG/M
3300020003|Ga0193739_1065847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes926Open in IMG/M
3300020016|Ga0193696_1158891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea552Open in IMG/M
3300021951|Ga0222624_1187458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea849Open in IMG/M
3300022756|Ga0222622_10126577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1614Open in IMG/M
3300022880|Ga0247792_1037960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea867Open in IMG/M
3300022886|Ga0247746_1032149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1172Open in IMG/M
3300022894|Ga0247778_1048872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1063Open in IMG/M
3300022898|Ga0247745_1054367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea638Open in IMG/M
3300022899|Ga0247795_1001190All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4368Open in IMG/M
3300022906|Ga0247766_1032641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1289Open in IMG/M
3300023062|Ga0247791_1043947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea698Open in IMG/M
3300023069|Ga0247751_1009145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1449Open in IMG/M
3300023069|Ga0247751_1021244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1016Open in IMG/M
3300023070|Ga0247755_1049466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea860Open in IMG/M
3300023073|Ga0247744_1063414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea620Open in IMG/M
3300023077|Ga0247802_1010369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1217Open in IMG/M
3300023270|Ga0247784_1035095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1202Open in IMG/M
3300024055|Ga0247794_10012177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2016Open in IMG/M
3300025223|Ga0207672_1010975Not Available552Open in IMG/M
3300025893|Ga0207682_10507983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea571Open in IMG/M
3300025907|Ga0207645_11018372Not Available560Open in IMG/M
3300025934|Ga0207686_11803666Not Available506Open in IMG/M
3300025945|Ga0207679_10342866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1300Open in IMG/M
3300026023|Ga0207677_10881914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea806Open in IMG/M
3300027992|Ga0247750_1042828Not Available513Open in IMG/M
3300028381|Ga0268264_12523546Not Available519Open in IMG/M
3300031538|Ga0310888_10654312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea641Open in IMG/M
3300031547|Ga0310887_11009879Not Available531Open in IMG/M
3300031892|Ga0310893_10055760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1329Open in IMG/M
3300031908|Ga0310900_10304283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1174Open in IMG/M
3300031908|Ga0310900_10488986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes954Open in IMG/M
3300031913|Ga0310891_10115146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea841Open in IMG/M
3300031944|Ga0310884_10127154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1286Open in IMG/M
3300032012|Ga0310902_10714520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea676Open in IMG/M
3300032012|Ga0310902_10826558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea633Open in IMG/M
3300032013|Ga0310906_10624818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea745Open in IMG/M
3300032075|Ga0310890_10858283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea722Open in IMG/M
3300032075|Ga0310890_11004053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Pseudobacter → Pseudobacter ginsenosidimutans671Open in IMG/M
3300032179|Ga0310889_10299666All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea775Open in IMG/M
3300032211|Ga0310896_10576434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea625Open in IMG/M
3300032211|Ga0310896_10803397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea539Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil34.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil14.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil10.28%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter3.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023270Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025223Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1271286613300000891SoilKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMD
JGI24034J26672_1012462513300002239Corn, Switchgrass And Miscanthus RhizosphereIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVKVKVSKIAWPSPSRLYDYIAKNISLNSTAGTLSVNQIFISPRLGENAFV
Ga0063356_10631295513300004463Arabidopsis Thaliana RhizosphereSYQSAEKDNKVPSMVFNIDIPEINVVGVKTTSALIDKEIIGRKLEIKNPIIDLQYTYRGKDSRRNVPTEEIYRQILGNMDMIQIDSVLITGAQLRTSNRKTGKLIIDVKKIDLSLLDVKVDSIGSADSTRILFSKGVNVNVAKIAWPSPNRLYDYISENISLNSTARTL
Ga0062592_10235940213300004480SoilELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAK
Ga0065712_1048424413300005290Miscanthus RhizosphereTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNKLYDYIAKNISLNSTAGTLSVN
Ga0068869_10049290813300005334Miscanthus RhizosphereLYLSRRGNGFRKRDSFKANGRELLKSQFNYHILKASGSMLFLLLCCRLNSIRWNSNCFIDLMKLNSPSEVKGGKRNTIKIVLISISFLILAMIGFGFLYWNTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDELSGSLSVRNMKLRFDSTRYQSIEKEGKVPSMVFNIDIPEINVAGVKTTSALIDREIIGRKLEIKNPIIDLQYTYRGKDSVRNVPTEEVYRQILGNMDLIQIDSVLITGAQLRTRNRNTGKLIIDVKNIDLSLRDVKVDSIADADTTRILFAKRINVTVAKIAWPSPNKLYDYIAENISLNSTAGTLSVDQILISPRLGEEAFVNA
Ga0070675_10014919813300005354Miscanthus RhizosphereMKSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLIDVKVDSAAYMDSTRFLFAKGIQVNVSKI
Ga0070662_10141061413300005457Corn RhizosphereKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVKVKVSKIAWPSPNRLYDY
Ga0070706_10179753513300005467Corn, Switchgrass And Miscanthus RhizosphereDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIAWPSPNRLYDYIAKNISLNSTAGTVSVNQIFISPRLEE
Ga0070686_10127433013300005544Switchgrass RhizosphereFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVKVKVSKIAWPSPSRLYDYIAKNISLNSTAGTLSVNQI
Ga0068859_10006081183300005617Switchgrass RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVK
Ga0068860_10149575213300005843Switchgrass RhizosphereEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIAWPSPN
Ga0066652_10036213123300006046SoilMRSNSGSNEKGKRTRRIKMILVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDVKIDETSGYLSAHNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPAQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLYDY
Ga0066653_1045882213300006791SoilIIGFGFLYWNTHKNKIIKTELEKTIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELQNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPAQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLNDVKVDSGAYMDRSRILFAKGVKVKVSKIAWPSPNKLYDY
Ga0075428_10187111613300006844Populus RhizosphereFVVLAIIGSGYFYWNTNKNKIIKTELEKALVKNNKGFYKISYGDLTIDETAGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEIKVIGVRTARALLDKEIVGRRLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSGFLFAKGVKVKV
Ga0075419_1060076413300006969Populus RhizosphereMKLNSSSPVKSTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVSITGAQIRTRNRNSGKLIIAVKDVDFSLMDVKVDSAA
Ga0111538_1147519613300009156Populus RhizosphereMRSNYGSKVGGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKTIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELQNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAK
Ga0111538_1396591513300009156Populus RhizosphereIAVGWWLWATHKNKIIKTEFEKAIVKSNKGFYKVSYDDMKIDESAGALSIRNMKLQFDSTSYLSIEKNGKVPSMVFDIDIPEINVVGVKTTKALLEKEIIGRKLEIKNPVIDLQYTYKGNDSLRNVPTQEMYRQILGNMDMIQVDSVLITGAQLRTSNRTTGKLIIEVNN
Ga0105249_1231787913300009553Switchgrass RhizosphereETSGYLSARNMKVRFDSARYQLSELKNKVPSIVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSVRNVPTQEVYRQILGNMDMIQIDSVLITGAQIRTSNRNSGNLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVNVSKIAWPSPDRLYDYIAKNISLNSTAGTLSVNQIFISPTLGENAF
Ga0134123_1219496813300010403Terrestrial SoilIFGFGFLYWNTHKNKIIKTELEKAIVKNNNGFYKMSYDDMKIDEVAGALSVRNMKLRFDSARYQSLEKENKIPSMIFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSDRNVPTQEVYRQILGNMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLKDVKVDSAAFMDSTRFLFAKGINVNVAK
Ga0137437_129754713300011442SoilEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSQLENKVPSMVFNIDIPEINVMGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYKDRSRFLFAKGVKVKVSK
Ga0157304_107339813300012882SoilISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVSITGAQIRTRNRNSGKLIIAVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWASPNRLYDYIANNISLN
Ga0157304_110794513300012882SoilKLRFDSARYQSLEKENKVPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDKSRFLFAKGVKVKVAKIAWPSPNRLYDYIAKNISLNST
Ga0157281_100642013300012883SoilMKLNSPSPVKSTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYQQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLIDVKVDSAAYMDSTRFLFAKGIQ
Ga0157281_102097013300012883SoilMKLNSSSEDKGTKRHTVKIVLISSSFFFLAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDPATYQSLEKENKVPSMVFNIDIPEISVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQIDSVLITGAQIRTSNRKSGKLIIAIKDVDFSFMDVKVDSAAY
Ga0157287_107423013300012885SoilPSPVKGTKGKTIKIVLISISFLLLAIIGFGFLYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVK
Ga0157305_1006670613300012891SoilMGINSGSKVKVNRKNRIKIVLISILFFVLAIIGVGFFYWTTHKNKIIKTELEKAIVKNNNGFYKIDYDDMKIDEAAGALSVRNMKLRFDSARYRSLEKENKAPSMVFNVDIPEINIVGVRTTRALLDKEIVGRKLEIRNPVIDLQYTYKGKDSDRSVPTQEVYRQILGNMDMIQIDSVLISGAQIRTSNRNSGKLIIDVKDVNFSLTDVKVDSAAYMDSTRYLFAKGINVNVAMIAWPSSNRLYDY
Ga0157294_1006090813300012892SoilIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDEAAGYLTGLIRWNSNCFIGIMKLNSSSRVKGTTGKTIKIVLISISFLLLVIIGVGFLYWDTHKNKIIKTELEKAIVKKNKGFYKISYDDMRIDETAGYLTARNMKVRFDSTRYQSSELENKIPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKVEIKNPIIELQYTYKGKDAIRNVPTQEIYRQILGDMDLIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVK
Ga0157284_1026652313300012893SoilMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIEVKDVDFSLTDVKVDSAAYMDNSRFLFAKDVKVKVAKIAWPSPNRLYDYIAKNISLNSAAGTLSVSQI
Ga0157309_1002368613300012895SoilMRSNYGSNKEGKRKRRIKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYKSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVK
Ga0157292_1011254113300012900SoilMRSNYGSNKEGKRKRRIKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKVIIDVKDVN
Ga0157288_1007822413300012901SoilMRSNFGSYEEGKRKRRNKIVLVSVLVFVLAIIGFGFLYWSTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELRNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVK
Ga0157289_1006117213300012903SoilMRSNYGSNKEGKRKRRIKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDLIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWP
Ga0157296_1002971813300012905SoilMRSNSGSNEEVKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQLSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKVIIDVKDVDFSLM
Ga0157295_1024616913300012906SoilELEKAIVKNNKGFYKISYDDMKIDETSGYLSAHNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPSKLYDYI
Ga0157283_1028999213300012907SoilQSSELKNKVPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNKLYDYIAKNISLNSTAGTLSVNQIFISPRLGENAFVNAI
Ga0157290_1021879613300012909SoilIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYKSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKVIIDVKDVDFALMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLYDYIAKYFIEFNCRNTVRKSNI
Ga0157308_1029186413300012910SoilAGYLTARNMKVRFDSTRYQSSELENKIPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVSITGAQIRTRNRNSGKLIIAVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIEWPSPNRLYDYIAKNISLNSTAGTLTVNQIFISPRLG
Ga0157308_1031544413300012910SoilAGYLTARNMKVRFDSTRYQSSELENKIPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDSSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPDRLYDYIAKNISLNSTAGTLSVNQILI
Ga0157306_1004917923300012912SoilMRSNSGSNEERKRKRRIKIVLVSVLVFVLAIVGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNKLYD
Ga0157298_1003479123300012913SoilMKLNSSSPVKGTKGKTIKIVLISISFLLLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLKDVK
Ga0157310_1018623113300012916SoilIRWNSNCFIGIMKLNSSSPVKGTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIYSVSITGAQIRTRNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIA
Ga0164308_1166789113300012985SoilIISILCFLLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIAVKDVDLSLIDLKVDSAAY
Ga0163163_1315468413300014325Switchgrass RhizosphereMVFNIDIPKINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGNMDMIQIDSVSITGAQIRTSDRNSGRLIIDVKNVDFSLMDVKVDSAAYMDSTRFLFAKGVNMKVAKIAWPSPNRLYDYIAENISLNSTAGALSVDQILIRPRLGENA
Ga0157380_1050134913300014326Switchgrass RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIAW
Ga0157380_1107437923300014326Switchgrass RhizosphereMRLNSGSKVKEKGRGRIKIVLISSLVFVLAIIGFGFFYWTTHKNKIIKTELEKAIVKNNDGFYKISYDDMKIDEVSGSLSVRNMKLRFDSARYQSLEKENKVPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSVRNVPTQEVYRQILGNMDMIQIDSVLITGAQIRTSNRNSGNLIIDVKDVDFSLMDVKVD
Ga0157377_1099767313300014745Miscanthus RhizosphereNTIKIIFISISISILAIIGFGFWYWNTHKNKIIKTELEKAIVKNNNGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFA
Ga0173480_1077645813300015200SoilTGKTIKIVLISISFLLLVIIGVGFLYWDTHKNKIIKTELEKAIVKKNKGFYKISYDDMRIDETAGYLTARNMKVRFDSTRYQSSELENKIPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEIKNPIIELQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLTDVKIDSA
Ga0173478_1000944813300015201SoilMKLNSSSEDKGTKRHTVKIILISSSFFLLAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDPATYQSLEKENKVPSMVFNIDIPEISVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQIDSVLITGAQIRTSNRKSGKLIIAIKDVDFSFMDVKVD
Ga0132257_10241519513300015373Arabidopsis RhizosphereIVIMKLNSSSSVQGTNRNTSKIVLISISFFLLAIIGFGFWYWTTHKNKIIKTELEKAIVKNNNGFYKVSYDDMKIDEVAGSLSVRNMKLRFDSTRYQSSEKENKTPSMIFDIDIPELNVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFL
Ga0163161_1041389723300017792Switchgrass RhizosphereMRSNYGSNKEGKRKRRIKIVLVSILVFVLAIIGFGFLYWNTNKDKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYQQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLIGVKVDSAAYMDSTRFLFAKGIQVNVSKIAWPS
Ga0163161_1104711113300017792Switchgrass RhizosphereLNTNKDKIIKTELEKAIVKSNKGFYKISYDNMKIDETSGYLSARNMKVRFDSARYQSSELNNKVSSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVKVKVSKIAWPSPNKLYDYIAKNISLNSTAGTLSVNQIFISPT
Ga0184634_1025044613300018031Groundwater SedimentAKVKENKRNRGKIVLISILFFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSTRYQTSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNIPTQEIYQQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLKDVKVDSAAYMDRSRFLFAKDVKVKVAKIAWPSPNKLYDYIAKNISLNSTAGTLSVNQIFISPRLGENAF
Ga0184611_126395713300018067Groundwater SedimentYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFVKGVKVKVAKIAWPSPNKLYDYIAKNISLNSTAGTLSVN
Ga0184611_127146313300018067Groundwater SedimentYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNKLYDYIAKNISLNSAAGTL
Ga0190274_1080686723300018476SoilMRSNSGSNEEGKRKRRIKIVLVSVLVFILAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVK
Ga0190274_1168020213300018476SoilNSPSPVKGSKGNTIKIVLISISFLLLAIIGFGLLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMRIDETAGYLSARNMKVRFDSTRYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYEGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTRNRNSGKLIIDIKDVDFSLMDVKVDSAAYMDSTRFLFAKGINVNVAKIAWPSSNRRYD
Ga0190274_1233908813300018476SoilNNGFYKIDYDDMKIDETVGSLSVRNMKLRFDSARYQLSDKENKAPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSYRNVPTQEVYRQILGNMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDSTRFLFAKGIKVNVAKIAWPSPDRLYDYIAKNISLNSTAATLSVNQILIR
Ga0173481_1001942113300019356SoilMKLNSPLEIKDTKRNIIKINLISISISILAIIGFGFWYWNTHKNTIIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERNGKAPSMVFNIDIPEINVVGVKTTKALLDKEIIGRKLEVKNPVIDLQYTYKGKDSIRNVPTQEIYREILGNMDMIQIDSVLITGAQLRTSSRNTGKLIIDIKKIDLSLIDVKVDSIGSADSTR
Ga0173481_1035721113300019356SoilIIKTELEKAIVKNNKGFYRISYDDMKIDETAGYLTARNMKVRFDSTRYQSSELENKVPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIEVKDVDFSLTDVKVDSAAYMDNSRFLFAKDVKVKVAKIAWPSPNRLYDYIAKNISLNSAAGTLSVSQIFISPRLGENAFVN
Ga0173482_1055085913300019361SoilSSSFLILAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDSATYQSLEKENKVPSMAFNIDIPEISVAGVRTTRALLGKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQIDSVLITGAQIRTSNRKSGKLLIAIKDVDFCFMDVKV
Ga0173479_1061490913300019362SoilIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIA
Ga0193702_100425043300019871SoilMKSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIAWPSPNRLYDYIAKNISLNSTAGTLS
Ga0193711_103392913300019997SoilLAMIGFGFLYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDELTGSLSVRNMKLRFDSTRYQSFEKGGKVPSMVFNIDIPEINVAGVKTTSALIDREIIGRKLEIKNPIIDLQYTYRGKDSVRNVPTEEVYRQILRNMDMIKIDSVLITGAQLRTRNRNTGKLIIDVKNIDLSLRDVKVDSIADADTTRILFAKRINVTVAKIAWPS
Ga0193692_1000659153300020000SoilMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDV
Ga0193692_110372213300020000SoilVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNDGFYKISYDNMKIDEVAGSLSVRNMKLRFDSVRYQSLEKENKVPSMVFNIDIPEINVAGVRTTRALLDKEIVGRKLEIRNPIIDLQYTYRGKDSIRNVPTREVYRQILGNMDMIQIDSVLITGAQIRTSNRNSGRLIIDVKDVNFSLMDVKVDSAAYMDSTRFLFA
Ga0193739_106584723300020003SoilMRLNSESKVKGNRKNKVKIVLISILLFVLLVASFGFFYWTTHKNKIIKTELEKAIVKNNNGFYKISYDDMKIDEVVGSLSVRNMKLRFDSARYQSAEKVNKVPSMVFDIEIPEINVVGVRTTRALLDKEIVGRKIEIKNPIIDLQYTYKGKDSIRNVPTQEVYRQILGNMDMIQFDSVLITGAQIRTSNRNSGKLIIDIK
Ga0193696_115889113300020016SoilVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRLLFAKGVKVKVAKIAWPS
Ga0222624_118745813300021951Groundwater SedimentMRSNFVSKEEGKSRRRVKIVLVSILVFVLAIIGIGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGRDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDNAAYMDRSRFLFAKGVKVKVSKIAWPSPNKLYDYIAKNISLNSTAG
Ga0222622_1012657733300022756Groundwater SedimentMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDV
Ga0247792_103796013300022880SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQTSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVSITGAQIRTRNRNSGKLIIAVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWASPNRLYDYIANNISLNSADGTLSVNQ
Ga0247746_103214913300022886SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLY
Ga0247778_104887213300022894Plant LitterMELNSESKVKEKRRRRSKIAIISILCFILAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSIVFNIDIPEINVIGVRTARALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRNVPTQEIYQQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMD
Ga0247745_105436713300022898SoilISSSFLILAVMGFGFWYWTTHKNKIIKTELEKAIVKSNKGFYKVSYDDMKIDEIVGSLFVRNMKLRFDSATYQSLEKENKVPSMVFNIDIPEISVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDSIRHVPTQEVYRQILGNLDMIQIDSVLITGAQIRTSNRKSGKLIIAIKDVDFSFMDVKVDSAAYMDSTRFLFAKGIKVNVA
Ga0247795_100119073300022899SoilMKLNSSSPVKSTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVSITGAQIRTRNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLYDYIANNIS
Ga0247766_103264113300022906Plant LitterMRSNYGSNKEGKRKRRIKIVLVSILVFVLAIIGFGFLYWNTNKDKIIKTELEKAIVKSNKGFYKISYDNMKIDETSGYLSARNMKVRFDSARYQSSVLENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLF
Ga0247791_104394713300023062SoilFDVMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVK
Ga0247751_100914513300023069SoilLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIA
Ga0247751_102124423300023069SoilMKLNSPLEIKDTKRNIIKINLISISISILAIIGFGFWYWNTHKNTAIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERNGKAPSMVFNIDIPEISVVGVKTTKALLDKEIIGRKLEVKNPVIDLQYTYKGKDSIRNVPTQEIYREILGNMDMIQIDSVLITGAQLRTSSRNTGKLIIDIKKIDLSLIDVKVDSIGSADSTRVLFSKEMNVKVAKIAWPSPNRLYDYIAENISLNSAVRTLSVNQILIRPRQGENAFVN
Ga0247755_104946613300023070Plant LitterMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLYDYIAKNISLNS
Ga0247744_106341413300023073SoilISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKSNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQTSELENKIPSMVFNIDIPEINIVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKG
Ga0247802_101036913300023077SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGK
Ga0247784_103509513300023270Plant LitterMRSNFGSNEEGKRKRRIKIVLGSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKVIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIA
Ga0247794_1001217753300024055SoilMKSNSPLEIKDTKRNTIKIIFISISISILAIIGFGFWYWNTHKNTIIKTELEKAIVKSNKGFYKVSYDDMKIDESAGALSIHNMKLRFDSASYQSFERNGKAPSMVFNIDIPEINVVGVKTTRALLDKEIIGRKLEVKNPVIDLQYTYKGKDSIRNVPTQEIYREILGNMNMIQIDSVLITGAQLRTSSRNTGKLIIDV
Ga0207672_101097513300025223Corn, Switchgrass And Miscanthus RhizosphereSYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPSKLYDYIAK
Ga0207682_1050798313300025893Miscanthus RhizosphereRRIKIVLVSVLVFVLAIVGFGFLYWNTHKNKLIKTELKKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVD
Ga0207645_1101837213300025907Miscanthus RhizosphereISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIAWPSPDRLYDYIAKN
Ga0207686_1180366613300025934Miscanthus RhizosphereYKISYDNMKIDETSGYLSARNMKVRFDSARYQSSVLENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKV
Ga0207679_1034286613300025945Corn RhizosphereMRSNFGSKEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSARNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVKVKVSKIAWPSPSRLYDYIAKNISLNSTAGTLSVNQVFISPRLGENAFVNAKLYHALVLWAAIEKQLGNTRKEHYYKLF
Ga0207677_1088191413300026023Miscanthus RhizosphereMKSNSGSNEEGKRKRRIKIVLVSVLVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKRVKVKV
Ga0247750_104282813300027992SoilNISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSMVFNIDIPEINIIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAVRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAK
Ga0268264_1252354613300028381Switchgrass RhizosphereKIDETAGYLSAHNMKVRFDSARYQSSELENKVPSMVFSIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVSKIAWPSPNKL
Ga0310888_1065431213300031538SoilAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSQLENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDIDFSLMDLRIDSAAYMDSTRFLFAKGVNANVDKIAWPSPNR
Ga0310887_1100987913300031547SoilVPSIVFTIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRLLFAKGVKVKVAKIAWPSPNKLYDYIAKNISLNSTAGTLSVNQIFISPRVGENAFV
Ga0310893_1005576033300031892SoilMRSNSELKVKRETRGRIKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSSRYQSSQLENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGARLRTSNRNTGKSIIE
Ga0310900_1030428313300031908SoilMRSNSELKVKRETRGRIKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSQLENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKVIIDVKDVDFALMDVKVDSAAYMDRSRFLFAK
Ga0310900_1048898613300031908SoilMLFLLLLYQRNPIRWNSNCLIDIMKLNSQVKNTKRNSPKIVWISISFSLLVMMAAGFLYWNTHKNKIIKTELEKAIVKSNKGFYKVNYDDMKIDESAGSLSIRNMKLRFDSSIYQSFVEKGGKVPSMIFNIEIPEINVVGVKTTRALLDKEIIGRKLEIKNPVIDLQYTYKGKDSIRNAPTQEIYRQILGNMDMIQIDSVLITGARLRTSNRNTGKLIIEVNNIDLSLLD
Ga0310891_1011514613300031913SoilVKASGSMLFLLLLYQRNPIRWNSNCLIDIMKLNSQVKNTKRNSPKIVWISISFSLLVMMAAGFLYWNTHKNKIIKTELEKAIVKSNKGFYKVNYDDMKIDESAGSLSIRNMKLRFDSSIYQSFVEKGGKVPSMIFNIEIPEINVVGVKTTRALLDKEIIGRKLEIKNPVIDLQYTYKGKDSIRNAPTQEIYRQILGNMDMIQIDSVLITGARLRTSNRNTGKSIIEVNNIDLSLLDVKVDSIGSLDSTRILFSKSMNANVAKIAWPSPNRLYNYTAEHI
Ga0310884_1012715413300031944SoilMMAAGFLYWNTHKNKIIKTELEKAIVKSNKGFYKFNYDDMKIDESAGSLSIRNMKLRFDSSIYQSFVEKGGKVPSMIFNIEIPEINVVGVKTTRALLDKEIIGRKLEIKNPVIDLQYTYKGKDSIRNAPTQEIYRQILGNMDMIQIDSVLITGARLRTSNRNTGKLILEVNNIDLSLLDVKVDSIGSLDSTRILFSKSMNANVAKIAWP
Ga0310902_1071452013300032012SoilMRSNSGSNEEGKRKRRVKIVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGK
Ga0310902_1082655813300032012SoilYWNTHKNRIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELKNKVPSIVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDATRKVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRLLFAKGVKVKVAKIAWPSPNRLYDYIA
Ga0310906_1062481813300032013SoilKIVLISILLFILAIVGFGFFYWNTHKNKIVKTELEKAIVKNNNGFYKISYDDMKIDETAGYLSVRNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLYDYIAKNISLNSAAGILSVNQI
Ga0310890_1085828313300032075SoilIMKLNSPSPVKSTKGNTIKIVLISISFLLLAIIGFGFFYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNTGKLIIDVKDVDFSLNDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPS
Ga0310890_1100405313300032075SoilKFNYDDMKIDESAGSLSIRNMKLRFDSSIYQSFVEKGGKVPSMIFNIEIPEINVVGVKTTRALLDKEIIGRKLEIKNPVIDLQYTYKGKDSIRNAPTQEIYRQILGNMDMIQIDSVLITGARLRTSNRNTGKLIIEVNNIDLSLLDVKVDSIGSLDSTRILFSKSMNANVAKIAWPSPNRLYNYTAEHISLNSTAGTLSVNQILISPRLGENAFVNSIQTQDD
Ga0310889_1029966613300032179SoilVLVSILVFVLAIIGFGFLYWNTHKNKIIKTELEKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQASELENKVPSMVFNIDIPEINVIGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKDVDFSLMDVKVDSAAYMDRSRFLFAKGVKVKVAKIAWPSPNRLYDYIAKNISLNSAAGILSVNQIFISPRLGENEF
Ga0310896_1057643413300032211SoilKAIVKNNKGFYKISYDDMKIDETSGYLSARNMKVRFDSARYQSSQLENKVPSMVFNIDIPEINVVGVRTTRALLDKEIVGRKLEIKNPIIDLQYTYKGKDAIRNVPTQEIYRQILGDMDMIQIDSVLITGAQIRTSNRNSGKLIIDVKNIDFSLMDLRIDSAAYMDSTRFLFAKGVNANVDKIAWPSPNRLYDYIAKNISLNSTAGTL
Ga0310896_1080339713300032211SoilNTHKNKIIKTELEKAIVKSNKGFYKVNYDDMKIDESAGSLSIRNMKLRFDSSIYRSFVEKGGKVPSMVFYIEIPEINVVGVKTTRALLDKEIIGRKLEIKNPVIDLQYTYKGKDSIRNAPTQEIYRQILGNMDMIQIDSVLITGARLRTSNRNTGKSIIEVNNIDLSLLDVKVDSIGSL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.