| Basic Information | |
|---|---|
| Family ID | F091759 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LEGVEVMMPGTAPKILREATREHRYVLQSAGFYGRLPWPVSW |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 83.18 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.299 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.009 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00590 | TP_methylase | 83.18 |
| PF13709 | DUF4159 | 15.89 |
| PF00535 | Glycos_transf_2 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002560|JGI25383J37093_10038819 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300002908|JGI25382J43887_10063463 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300002908|JGI25382J43887_10301673 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300004062|Ga0055500_10095811 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300004463|Ga0063356_100299885 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300005166|Ga0066674_10473466 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005171|Ga0066677_10005755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5051 | Open in IMG/M |
| 3300005174|Ga0066680_10139054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1513 | Open in IMG/M |
| 3300005175|Ga0066673_10445888 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005175|Ga0066673_10478120 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005177|Ga0066690_10172767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1429 | Open in IMG/M |
| 3300005345|Ga0070692_10228465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1103 | Open in IMG/M |
| 3300005444|Ga0070694_100041663 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300005446|Ga0066686_10327067 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005447|Ga0066689_10015222 | All Organisms → cellular organisms → Bacteria | 3629 | Open in IMG/M |
| 3300005450|Ga0066682_10423694 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005536|Ga0070697_101423634 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005552|Ga0066701_10950793 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005553|Ga0066695_10084718 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300005553|Ga0066695_10421912 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005554|Ga0066661_10795972 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005568|Ga0066703_10123504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1541 | Open in IMG/M |
| 3300005586|Ga0066691_10088889 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300006031|Ga0066651_10057110 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300006034|Ga0066656_10296949 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300006791|Ga0066653_10550198 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006797|Ga0066659_11051019 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006804|Ga0079221_10024058 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300006804|Ga0079221_11051426 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300007255|Ga0099791_10431769 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300007258|Ga0099793_10297785 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300007788|Ga0099795_10303422 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300009012|Ga0066710_100187235 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300009012|Ga0066710_100267948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2482 | Open in IMG/M |
| 3300009012|Ga0066710_103175749 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009162|Ga0075423_11815758 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009678|Ga0105252_10364127 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010104|Ga0127446_1133642 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010321|Ga0134067_10033393 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300010323|Ga0134086_10048755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1432 | Open in IMG/M |
| 3300010333|Ga0134080_10011563 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
| 3300010333|Ga0134080_10173678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 923 | Open in IMG/M |
| 3300010336|Ga0134071_10114492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1291 | Open in IMG/M |
| 3300010362|Ga0126377_10749243 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1032 | Open in IMG/M |
| 3300012198|Ga0137364_10309519 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300012199|Ga0137383_10195021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1484 | Open in IMG/M |
| 3300012201|Ga0137365_10026386 | All Organisms → cellular organisms → Bacteria | 4486 | Open in IMG/M |
| 3300012201|Ga0137365_11341808 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012203|Ga0137399_10841139 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
| 3300012211|Ga0137377_10655243 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012285|Ga0137370_10180898 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300012350|Ga0137372_10113813 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
| 3300012351|Ga0137386_10726362 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300012356|Ga0137371_11140556 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012356|Ga0137371_11385844 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012357|Ga0137384_10424026 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300012403|Ga0134049_1068238 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300012683|Ga0137398_10326730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1035 | Open in IMG/M |
| 3300012918|Ga0137396_10161958 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300012918|Ga0137396_10432806 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300012925|Ga0137419_10162934 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300012927|Ga0137416_10637400 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012930|Ga0137407_11818292 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012972|Ga0134077_10235158 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012972|Ga0134077_10285455 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300015054|Ga0137420_1381507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 935 | Open in IMG/M |
| 3300015241|Ga0137418_10076557 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
| 3300015358|Ga0134089_10425698 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300017657|Ga0134074_1048641 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300017659|Ga0134083_10041202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1716 | Open in IMG/M |
| 3300018056|Ga0184623_10401155 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300018063|Ga0184637_10178486 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300018082|Ga0184639_10538482 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018084|Ga0184629_10556447 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018431|Ga0066655_10949450 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300018431|Ga0066655_11410069 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018433|Ga0066667_10002261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7634 | Open in IMG/M |
| 3300018433|Ga0066667_10221818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1409 | Open in IMG/M |
| 3300018433|Ga0066667_11283135 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018468|Ga0066662_10395384 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300018482|Ga0066669_11998866 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300019789|Ga0137408_1165985 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300021046|Ga0215015_10366991 | All Organisms → cellular organisms → Bacteria | 3683 | Open in IMG/M |
| 3300022204|Ga0224496_10056198 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300025912|Ga0207707_10993066 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300026025|Ga0208778_1021298 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300026295|Ga0209234_1011516 | All Organisms → cellular organisms → Bacteria | 3363 | Open in IMG/M |
| 3300026301|Ga0209238_1139334 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300026317|Ga0209154_1057426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1719 | Open in IMG/M |
| 3300026317|Ga0209154_1189136 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300026333|Ga0209158_1115230 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300026343|Ga0209159_1025648 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3229 | Open in IMG/M |
| 3300026343|Ga0209159_1136543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 997 | Open in IMG/M |
| 3300026536|Ga0209058_1085101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1646 | Open in IMG/M |
| 3300026537|Ga0209157_1257400 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300026542|Ga0209805_1041003 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300027725|Ga0209178_1280004 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027875|Ga0209283_10163542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1477 | Open in IMG/M |
| 3300027903|Ga0209488_10029448 | All Organisms → cellular organisms → Bacteria | 3998 | Open in IMG/M |
| 3300028784|Ga0307282_10414773 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300028814|Ga0307302_10426955 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031962|Ga0307479_10666916 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300032205|Ga0307472_101002722 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300033407|Ga0214472_10610235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1001 | Open in IMG/M |
| 3300033813|Ga0364928_0117376 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300033815|Ga0364946_052627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 848 | Open in IMG/M |
| 3300034354|Ga0364943_0221023 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25383J37093_100388193 | 3300002560 | Grasslands Soil | ALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSSGFYGRLPWQVSW* |
| JGI25382J43887_100634634 | 3300002908 | Grasslands Soil | NALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| JGI25382J43887_103016731 | 3300002908 | Grasslands Soil | LTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0055500_100958112 | 3300004062 | Natural And Restored Wetlands | VRVYLEPVEVMMPGTALKVIQVATWEHRYVLQAAGFYRRVPWPVKW* |
| Ga0063356_1002998851 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LQLLEGAEVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW* |
| Ga0066674_104734662 | 3300005166 | Soil | ALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0066677_100057555 | 3300005171 | Soil | LQGVEVIMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW* |
| Ga0066680_101390543 | 3300005174 | Soil | LEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW* |
| Ga0066673_104458881 | 3300005175 | Soil | DWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0066673_104781202 | 3300005175 | Soil | ALQLLEGVEIVMPGTAPKVLKDATREHRYVLQAAGFYGRLPWPVTW* |
| Ga0066690_101727671 | 3300005177 | Soil | DWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW* |
| Ga0070692_102284651 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLLEGAEVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWQVTW* |
| Ga0070694_1000416631 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | QLLETVEVVMPGAAPTILRDATREHRYVLQAAGFYNRLPWRVTW* |
| Ga0066686_103270671 | 3300005446 | Soil | WSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0066689_100152221 | 3300005447 | Soil | LLQGVEVIMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW* |
| Ga0066682_104236942 | 3300005450 | Soil | ELSNALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSTGYYGRLPWPVSW* |
| Ga0070697_1014236342 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VALGEWAKQLLEGVEIMMPGTAPQVLRDATREHRYLLQSAGFYDRLPWPVAW* |
| Ga0066701_109507932 | 3300005552 | Soil | LLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0066695_100847181 | 3300005553 | Soil | EIVMPGTAPKVLKDATREHRYVLQAAGFYGRLPWPVTW* |
| Ga0066695_104219121 | 3300005553 | Soil | SLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0066661_107959722 | 3300005554 | Soil | ALTDWSLQLLEGVEVMMPGTAPEILREATREHRYVLESAGFYGRLPWRVKW* |
| Ga0066703_101235041 | 3300005568 | Soil | MMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW* |
| Ga0066691_100888894 | 3300005586 | Soil | VEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW* |
| Ga0066651_100571101 | 3300006031 | Soil | SLQLLEGVEVMMPGTAPKILREATREHRYVLQSTGYYGRLPWPVSW* |
| Ga0066656_102969491 | 3300006034 | Soil | LQLLEGVEVMMPGTAPEVLREATREHRYVLESAGFYGRLPWRVKW* |
| Ga0066653_105501982 | 3300006791 | Soil | VMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0066659_110510192 | 3300006797 | Soil | AEVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW* |
| Ga0079221_100240584 | 3300006804 | Agricultural Soil | EIMMPGTAVKVLRGATREHRYVLQSAGFYDALPWSVTW* |
| Ga0079221_110514262 | 3300006804 | Agricultural Soil | MPGTAPKILREATREHRYVLQSAGYYGRMPWPVTW* |
| Ga0099791_104317692 | 3300007255 | Vadose Zone Soil | LQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0099793_102977851 | 3300007258 | Vadose Zone Soil | LLQGVEVMMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW* |
| Ga0099795_103034221 | 3300007788 | Vadose Zone Soil | TDWSLQLLEGVEVMMPGTAPKILREATRENRYVLQSAGYYGRLPWPVSW* |
| Ga0066710_1001872351 | 3300009012 | Grasslands Soil | LQLLEGVEVMMPGTAPKILREATREHRYVLQSTGYYGRLPWPVSW |
| Ga0066710_1002679484 | 3300009012 | Grasslands Soil | AEVMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW |
| Ga0066710_1031757492 | 3300009012 | Grasslands Soil | LLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0075423_118157581 | 3300009162 | Populus Rhizosphere | EVMMPGTAPKVLKDATREHRYVLQAAGFYGSLPWQVTW* |
| Ga0105252_103641271 | 3300009678 | Soil | LESAEVVMPGAASGILRDATREHRYVLQAAGFYDRLPWPVTW* |
| Ga0127446_11336421 | 3300010104 | Grasslands Soil | AEVMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0134067_100333931 | 3300010321 | Grasslands Soil | ALMDWSRQLLQGVEVIMPGTAPKILREATREHRYVLQAAGFYGQLPWPVTW* |
| Ga0134086_100487551 | 3300010323 | Grasslands Soil | WSLQLLEGVEVMMPGTAPEILREATREHRYVLESAGFYGRLPWRVKW* |
| Ga0134080_100115634 | 3300010333 | Grasslands Soil | EGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0134080_101736781 | 3300010333 | Grasslands Soil | IMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW* |
| Ga0134071_101144921 | 3300010336 | Grasslands Soil | SALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSSGFYGRLPWQVSW* |
| Ga0126377_107492431 | 3300010362 | Tropical Forest Soil | LEGAEVMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0137364_103095192 | 3300012198 | Vadose Zone Soil | WSLQLLEGVEVMMPGTAPKILREATREHRYVLQSTGYYGRLPWPVSW* |
| Ga0137383_101950211 | 3300012199 | Vadose Zone Soil | SALADWSLQLLEGVEVMMPGTAPEILREATREHRYVLESAGFYGRLPWRVKW* |
| Ga0137365_100263861 | 3300012201 | Vadose Zone Soil | MPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0137365_113418081 | 3300012201 | Vadose Zone Soil | LLEGAEVMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0137399_108411392 | 3300012203 | Vadose Zone Soil | LEGAEVMMPGTALKVLKEATREHRYVLQAAGFYGRLPWRVTW* |
| Ga0137377_106552432 | 3300012211 | Vadose Zone Soil | VMMPGTAPKILREATREHRYVLQSTGYYGRLPWPVSW* |
| Ga0137370_101808983 | 3300012285 | Vadose Zone Soil | LLEGAEVMMPGTAPKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0137372_101138134 | 3300012350 | Vadose Zone Soil | ANALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW* |
| Ga0137386_107263622 | 3300012351 | Vadose Zone Soil | PGTAPKILREATREHRYVLQSSGFYGRLPWPVTW* |
| Ga0137371_111405562 | 3300012356 | Vadose Zone Soil | GAEVMMPGTATKVLKDATREHRYVLQAANFYGRLPWRVTW* |
| Ga0137371_113858442 | 3300012356 | Vadose Zone Soil | LQLLEGVEIVMPGTAPKVLKDATREHRYVLQAAGFYGRLPWPVTW* |
| Ga0137384_104240261 | 3300012357 | Vadose Zone Soil | QLLEGAEVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW* |
| Ga0134049_10682384 | 3300012403 | Grasslands Soil | MMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0137398_103267301 | 3300012683 | Vadose Zone Soil | EGAEVMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW* |
| Ga0137396_101619583 | 3300012918 | Vadose Zone Soil | GAEVMMPGTALKVLKDATREHRYVLQAAGFYGRLPWRVTW* |
| Ga0137396_104328061 | 3300012918 | Vadose Zone Soil | LEGVEVMMPGTAPKILREATREHRYVLQSAGFYGRLPWPVSW* |
| Ga0137419_101629344 | 3300012925 | Vadose Zone Soil | VMMPGTAPKVLKDATREHRYVLQAAGFYARLPWQVTW* |
| Ga0137416_106374001 | 3300012927 | Vadose Zone Soil | TDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSSGYYGRLPWPVSW* |
| Ga0137407_118182921 | 3300012930 | Vadose Zone Soil | NALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYVRLPWPVAW* |
| Ga0134077_102351582 | 3300012972 | Grasslands Soil | QLLQGVEVIMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW* |
| Ga0134077_102854552 | 3300012972 | Grasslands Soil | WSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVAW* |
| Ga0137420_13815072 | 3300015054 | Vadose Zone Soil | EVMMPGTALKILKDATREHRYVLQAAGFYGRLPWRVTW* |
| Ga0137418_100765571 | 3300015241 | Vadose Zone Soil | LSTALTDWTLQLLEGAEVMMPGTAPKVLKDATREHRYVLQASGFYSRLPWQVTW* |
| Ga0134089_104256982 | 3300015358 | Grasslands Soil | TDWSLQLLEGVEVMMPGTAPKILRDATREHRYVLQSVGFYGRLPWPVTW* |
| Ga0134074_10486411 | 3300017657 | Grasslands Soil | AALMDWSRQLLQGVEVIMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW |
| Ga0134083_100412023 | 3300017659 | Grasslands Soil | LTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVAW |
| Ga0184623_104011551 | 3300018056 | Groundwater Sediment | MPGAAPKVLKDATREHRYVLQASGFYSRLPWQVTW |
| Ga0184637_101784863 | 3300018063 | Groundwater Sediment | WARQLFDGVEILMPGTAPKVLRDATRVHRYVLQSAGFYDRLPWPVTW |
| Ga0184639_105384822 | 3300018082 | Groundwater Sediment | LLEGAEVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW |
| Ga0184629_105564472 | 3300018084 | Groundwater Sediment | EILMPGTAPKVLRDATRVHRYVLQSAGFYDRLPWPVTW |
| Ga0066655_109494502 | 3300018431 | Grasslands Soil | WSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0066655_114100691 | 3300018431 | Grasslands Soil | LLEGVEVMMPRTAPTLLREATREHRYVLQSTGYYGRLPWPVSW |
| Ga0066667_100022616 | 3300018433 | Grasslands Soil | DWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0066667_102218183 | 3300018433 | Grasslands Soil | VEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0066667_112831352 | 3300018433 | Grasslands Soil | LQGVEVIMPGTAPKILREATREHRYVLQSAGFYGQLPWPVTW |
| Ga0066662_103953841 | 3300018468 | Grasslands Soil | QLLEGVEVMMPGTAPEILREATREHRYVLESAGFYGRLPWRVKW |
| Ga0066669_119988662 | 3300018482 | Grasslands Soil | VMMPGTALKVLKDATREHRYVLQAAGFYGRLPWRVTW |
| Ga0137408_11659851 | 3300019789 | Vadose Zone Soil | QLLEGVEVMMPGTAPKILREATREHRYVVLQSAGYYVRLPWPVAW |
| Ga0215015_103669911 | 3300021046 | Soil | ALSDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGFYGRLPWQVSW |
| Ga0224496_100561984 | 3300022204 | Sediment | LEPVEVMMPGTAPKVLQVATWEHRYVLQAAGFYRGMPWPVTW |
| Ga0207707_109930661 | 3300025912 | Corn Rhizosphere | VMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW |
| Ga0208778_10212982 | 3300026025 | Rice Paddy Soil | LEGVEVVMPGTAPKILREATREHRYVLQSAGYYGRLPWQVTW |
| Ga0209234_10115161 | 3300026295 | Grasslands Soil | SALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0209238_11393342 | 3300026301 | Grasslands Soil | ALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0209154_10574261 | 3300026317 | Soil | SALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW |
| Ga0209154_11891362 | 3300026317 | Soil | LQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW |
| Ga0209158_11152302 | 3300026333 | Soil | MMPGTAPKILREATREHRYVLQSSGFYGRLPWQVSW |
| Ga0209159_10256484 | 3300026343 | Soil | MMPGTALKVLKDATREHRYVLQAAGFYGRLPWRVTW |
| Ga0209159_11365431 | 3300026343 | Soil | GAEVMMPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW |
| Ga0209058_10851012 | 3300026536 | Soil | MMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0209157_12574002 | 3300026537 | Soil | MPGTATKVLKDATREHRYVLQAAGFYGKLPWRVTW |
| Ga0209805_10410034 | 3300026542 | Soil | ALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW |
| Ga0209178_12800042 | 3300027725 | Agricultural Soil | MPGTAPKILREATREHRYVLQSAGYYGRMPWPVTW |
| Ga0209283_101635421 | 3300027875 | Vadose Zone Soil | NALTDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0209488_100294484 | 3300027903 | Vadose Zone Soil | EGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0307282_104147731 | 3300028784 | Soil | TLQLLEGAEVMMPGTAPKVLKDATREHRYVLQASGFYSRLPWQVTW |
| Ga0307302_104269551 | 3300028814 | Soil | LLEGAEVMMPGTALKVLKDATREHRYVLQAAGFYGKLPWRVTW |
| Ga0307479_106669161 | 3300031962 | Hardwood Forest Soil | MPGTAPKILREATREHRYVLQSAGYYGRLPWQVSW |
| Ga0307472_1010027221 | 3300032205 | Hardwood Forest Soil | TDWSLQLLEGVEVMMPGTAPKILREATREHRYVLQSAGYYGRLPWPVSW |
| Ga0214472_106102351 | 3300033407 | Soil | EVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW |
| Ga0364928_0117376_482_637 | 3300033813 | Sediment | ALTDWTLQLLEGAEVMMPGTAPKVLKDATREHRYVLQASGFYSRLPWQVTW |
| Ga0364946_052627_3_140 | 3300033815 | Sediment | LQLLEGAEVMMPGTATKILKDATREHRYVLQAAGFYGRLPWQVTW |
| Ga0364943_0221023_560_700 | 3300034354 | Sediment | ALQLLEGAEVMMPGTAPKVLKDATREHRYVLQAAGFYGRLPWRVTW |
| ⦗Top⦘ |