NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091743

Metagenome / Metatranscriptome Family F091743

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091743
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 42 residues
Representative Sequence MGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSF
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 89.72 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 81.31 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(22.430 % of family members)
Environment Ontology (ENVO) Unclassified
(43.925 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.402 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 34.38%    β-sheet: 0.00%    Coil/Unstructured: 65.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07478Dala_Dala_lig_C 77.57
PF00571CBS 14.02
PF06144DNA_pol3_delta 1.87
PF03544TonB_C 0.93
PF05190MutS_IV 0.93
PF05192MutS_III 0.93
PF00488MutS_V 0.93
PF14681UPRTase 0.93
PF05036SPOR 0.93
PF05258DciA 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 2.80
COG1466DNA polymerase III, delta subunitReplication, recombination and repair [L] 1.87
COG2812DNA polymerase III, gamma/tau subunitsReplication, recombination and repair [L] 1.87
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.93
COG1193dsDNA-specific endonuclease/ATPase MutS2Replication, recombination and repair [L] 0.93
COG5512Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives)General function prediction only [R] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_119040746All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300002562|JGI25382J37095_10136653All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300002916|JGI25389J43894_1103101All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300004480|Ga0062592_100515571All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300005166|Ga0066674_10024111All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2652Open in IMG/M
3300005179|Ga0066684_10140523All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.1523Open in IMG/M
3300005440|Ga0070705_100563789All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300005444|Ga0070694_100385635All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300005454|Ga0066687_10664035All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005553|Ga0066695_10000120All Organisms → cellular organisms → Bacteria17100Open in IMG/M
3300005558|Ga0066698_10510332All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300005568|Ga0066703_10000066All Organisms → cellular organisms → Bacteria20496Open in IMG/M
3300005578|Ga0068854_100669450All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300005586|Ga0066691_10011567All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4132Open in IMG/M
3300005598|Ga0066706_10082664All Organisms → cellular organisms → Bacteria2283Open in IMG/M
3300005598|Ga0066706_10146642All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300005879|Ga0075295_1024189All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300006046|Ga0066652_101265862All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300006794|Ga0066658_10111783All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300006797|Ga0066659_10002761All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis8208Open in IMG/M
3300006797|Ga0066659_10603953All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300006797|Ga0066659_11516493All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006844|Ga0075428_100940749All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300006846|Ga0075430_100472970All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300006847|Ga0075431_101341141All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006904|Ga0075424_101678616All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300006914|Ga0075436_100025480All Organisms → cellular organisms → Bacteria4071Open in IMG/M
3300006914|Ga0075436_100607632All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300007258|Ga0099793_10002806All Organisms → cellular organisms → Bacteria5904Open in IMG/M
3300007764|Ga0102950_1209867All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009038|Ga0099829_11613989All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300009089|Ga0099828_10870288All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300009089|Ga0099828_11398702All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300009090|Ga0099827_10015465All Organisms → cellular organisms → Bacteria5123Open in IMG/M
3300009090|Ga0099827_11277521All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300009098|Ga0105245_11171743All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300010134|Ga0127484_1164138All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010301|Ga0134070_10020310All Organisms → cellular organisms → Bacteria2157Open in IMG/M
3300010304|Ga0134088_10047086All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300010304|Ga0134088_10056402All Organisms → cellular organisms → Bacteria1810Open in IMG/M
3300010373|Ga0134128_10434466All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300011438|Ga0137451_1014695All Organisms → cellular organisms → Bacteria2258Open in IMG/M
3300011438|Ga0137451_1080078All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300012035|Ga0137445_1094869All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012140|Ga0137351_1016433All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300012160|Ga0137349_1017421All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300012202|Ga0137363_10198998All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1606Open in IMG/M
3300012206|Ga0137380_10283920All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300012211|Ga0137377_10560866All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1080Open in IMG/M
3300012211|Ga0137377_11774189All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012349|Ga0137387_10109201All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300012349|Ga0137387_11057408All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300012351|Ga0137386_10593037All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300012354|Ga0137366_10622817All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012361|Ga0137360_10872092All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300012383|Ga0134033_1137596All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012386|Ga0134046_1266182All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012392|Ga0134043_1239058All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012402|Ga0134059_1036252All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012683|Ga0137398_10265275All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300012930|Ga0137407_10246947All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300012976|Ga0134076_10382437All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012976|Ga0134076_10534123All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300014154|Ga0134075_10034910All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300015054|Ga0137420_1281538All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300015200|Ga0173480_11106768All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300015245|Ga0137409_10091336All Organisms → cellular organisms → Bacteria2832Open in IMG/M
3300015359|Ga0134085_10058365All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300017654|Ga0134069_1327824All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300017657|Ga0134074_1092950All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300017657|Ga0134074_1311184All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300017659|Ga0134083_10113096All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1078Open in IMG/M
3300018077|Ga0184633_10303196All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300018078|Ga0184612_10524542All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300018433|Ga0066667_10927726All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300018468|Ga0066662_10026490All Organisms → cellular organisms → Bacteria3362Open in IMG/M
3300018468|Ga0066662_10495726All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300018482|Ga0066669_10117116All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300019869|Ga0193705_1073756All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300020059|Ga0193745_1135375All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300021046|Ga0215015_10484690All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300021086|Ga0179596_10659773All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300021363|Ga0193699_10030454All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300021418|Ga0193695_1008640All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas1997Open in IMG/M
3300022532|Ga0242655_10301908All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300024325|Ga0247678_1050017All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300025885|Ga0207653_10107461All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300025885|Ga0207653_10227396All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300026298|Ga0209236_1020106All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3741Open in IMG/M
3300026313|Ga0209761_1002398All Organisms → cellular organisms → Bacteria12318Open in IMG/M
3300026318|Ga0209471_1190450All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300026327|Ga0209266_1091728All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300026332|Ga0209803_1030364All Organisms → cellular organisms → Bacteria2563Open in IMG/M
3300026532|Ga0209160_1185148All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300026540|Ga0209376_1214324All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300026542|Ga0209805_1178385All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300026548|Ga0209161_10189708All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1150Open in IMG/M
3300026550|Ga0209474_10604053All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027748|Ga0209689_1349073All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300027862|Ga0209701_10025303All Organisms → cellular organisms → Bacteria3860Open in IMG/M
3300027903|Ga0209488_11236532All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300028536|Ga0137415_11415150All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300031421|Ga0308194_10316106All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031720|Ga0307469_10864547All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300032180|Ga0307471_101652738All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300033417|Ga0214471_10135476All Organisms → cellular organisms → Bacteria2030Open in IMG/M
3300034178|Ga0364934_0242829All Organisms → cellular organisms → Bacteria682Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil22.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil14.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007764Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012140Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11904074613300000956SoilMGPQRMYGLTTWVRRLLVANLLVFLVQNTLFTDATLTNAFAF
JGI25382J37095_1013665323300002562Grasslands SoilMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGF
JGI25389J43894_110310113300002916Grasslands SoilMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFSPA
Ga0062592_10051557123300004480SoilMTWRPEGEMGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVAA
Ga0066674_1002411133300005166SoilMGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSFAGAFGFSP
Ga0066684_1014052313300005179SoilMGPQRMYGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFGFAP
Ga0070705_10056378913300005440Corn, Switchgrass And Miscanthus RhizosphereMGPQRMYGLTIWVRRLLVVNLLVFLIQSTLLTSPSFAGAF
Ga0070694_10038563523300005444Corn, Switchgrass And Miscanthus RhizosphereMGPQRMYSLTLWVRRLLVANLLVFLIQKTLLIDPKYVAAFGFDPLQA
Ga0066687_1066403513300005454SoilMGPQRMYGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFGFAPLLAWKQ
Ga0066695_10000120203300005553SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQ
Ga0066698_1051033223300005558SoilMGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSFAGAFGFS
Ga0066703_10000066213300005568SoilMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFS
Ga0068854_10066945013300005578Corn RhizosphereMGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKY
Ga0066691_1001156713300005586SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRT
Ga0066706_1008266413300005598SoilMGPHRMFGMTPWVRRLMVANLVVFLFQVTLFVSPAFLTTLQ
Ga0066706_1014664213300005598SoilMGPQRMYGLTTWVRRLLVANLLVFLIQNTLFVDSNFIKAFAF
Ga0075295_102418923300005879Rice Paddy SoilMTPQRTFGMTPWVFRLLVANLLVYLLQVTVFVDPK
Ga0066652_10126586223300006046SoilMGPQRMYGLTLWVRRLLVANLLVFLIQKTVLIDPRYLEALGLVPLHALER
Ga0066658_1011178333300006794SoilMDPQRMFGMTPWVRRLVVANLVVFLLQVTLFVSPGFLA
Ga0066659_1000276193300006797SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVD
Ga0066659_1060395313300006797SoilMGPQRMYGLSPWVRRLLVANLLVFLVQNTLFATNPDF
Ga0066659_1151649323300006797SoilMGPQRMYGLTPWVRRLLVANLLVFLVQNTLFVDGTLTKALAFAPLDAWKQRSPQAR*
Ga0075428_10094074923300006844Populus RhizosphereMGPQRMYVLTPWVRRLLVANLIVFLFQVTLFTLQSSANMFGFIPLLAAQR
Ga0075430_10047297013300006846Populus RhizosphereMMTEDLLGPPRMYTLTPWVRRLLVANLIVFLFQATLFT
Ga0075431_10134114113300006847Populus RhizosphereMMTEDTLGPQRMYVLTPWVRRLLVANLIVFLFQVTLLTL
Ga0075424_10167861623300006904Populus RhizosphereMMTEDLMGPPRMYALTPWVRRLLVANLIVFLFQVTLFTLQ
Ga0075436_10002548053300006914Populus RhizosphereMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFSPAHA
Ga0075436_10060763223300006914Populus RhizosphereMMTEDLMGPPRMYVLTPWVRRLLVANLIVFLFQVT
Ga0099793_1000280613300007258Vadose Zone SoilMGPQRMYSLTLWVRRLLVANLLVFLIQKTLLVDPSFLSAFGFDP
Ga0102950_120986723300007764SoilMFGMTTWVRRLLVANLLVFLLQLTIFAGPRFIAAFGLDPLQAA
Ga0099829_1161398913300009038Vadose Zone SoilMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFGFSP
Ga0099828_1087028813300009089Vadose Zone SoilMGPQRMFGMTPWVRRLIVANLIVFLLQMTIFVNPWFV
Ga0099828_1139870223300009089Vadose Zone SoilMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSFAGAFRFSPA
Ga0099827_1001546513300009090Vadose Zone SoilMGPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFIGTL
Ga0099827_1127752123300009090Vadose Zone SoilMTEDLMGPPRMYGLTPWVRRLLVANLIVFLFQATLF
Ga0105245_1117174323300009098Miscanthus RhizosphereMGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVA
Ga0127484_116413823300010134Grasslands SoilMGPQRLYGLTLWVRRLLVANLLVFLVQSTLLTSPSFRVALGFNPMHAWEQ
Ga0134070_1002031013300010301Grasslands SoilMGPQRIFGMTPWVRRLFVANLVVFLFQMTIFVDPRFLATFG
Ga0134088_1004708633300010304Grasslands SoilMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFGFT
Ga0134088_1005640233300010304Grasslands SoilMGTQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFGFT
Ga0134128_1043446613300010373Terrestrial SoilMFGMTPWVRRLLVANLLVFLLQETVFLKAAQFLAFDPLHA
Ga0137451_101469513300011438SoilMEDAPRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQAVFGFEPLLAVA
Ga0137451_108007823300011438SoilMMTEDLLGPPRMYALTPWVRRLLVANLIVFLFQATLFTSRAFTDTFGFV
Ga0137445_109486923300012035SoilMEDAPRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQAIFGFEPLFAAAR
Ga0137351_101643323300012140SoilMGPQRMYSLTVWVRRILVANLLVFLIQKTLLVDPKY
Ga0137349_101742123300012160SoilMEDAPRMFGMTPRVRRLLVANLLVFLCQKTVLVDPRFQAIFGF*
Ga0137363_1019899833300012202Vadose Zone SoilMGPQRMYGLTVWVRRLLVANLLVFLIQSTLLTSPSFADDFG
Ga0137380_1028392033300012206Vadose Zone SoilMDSQRMFGMTPWVRRLLVANLLVFLCQQTVLVDPRFQALFGFQPLYALERP
Ga0137377_1056086613300012211Vadose Zone SoilMDPQRMFGMTPWVRRLVVANLVVFLLQVTLFVSPGFLATFG
Ga0137377_1177418923300012211Vadose Zone SoilMDSQRMFGMTTWVRRLLVANLLVFLCQKTVLVDPRFQAVFGF
Ga0137387_1010920113300012349Vadose Zone SoilMMTEDLMGPPRMYVLTPWVRRLLVANLIVFLFQVTLFTLQGSANTFGFI
Ga0137387_1105740823300012349Vadose Zone SoilMFGLSLWVRRLLVANLLVFLIQKTLLVDPSFLNAF
Ga0137386_1059303713300012351Vadose Zone SoilMGPQRMFGMTPWVRRLMVACLFVFLLQSTLFTSPPFIRQFG
Ga0137366_1062281723300012354Vadose Zone SoilMDTQRVFGMTPWVRRLFAANLLVFVLQETVLGPRFLAAFGFAPLK
Ga0137360_1087209213300012361Vadose Zone SoilMGPQRMYGLTVWVRRLLVANLLVFLIQSTLLTSPSFADAF
Ga0134033_113759613300012383Grasslands SoilMGPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFIGTLGLTPLY
Ga0134046_126618213300012386Grasslands SoilMDPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFV
Ga0134043_123905813300012392Grasslands SoilMGPQRLYGLTLWVRRLLVANLLVFLVQSTLLTSPSFRVALG
Ga0134059_103625213300012402Grasslands SoilMFGLSLWVRRLLVANLLVFLIQKTLLVDPNSLKAFGFAPLLAWKQ
Ga0137398_1026527523300012683Vadose Zone SoilMYGLTPWVRRLLVANLLVFLIQNTLLTSASFADAFAFA
Ga0137407_1024694713300012930Vadose Zone SoilMGPQRMFGMTPWVRRLMVACLFVFLLQSTLFTSSAFVQQFG
Ga0134076_1038243713300012976Grasslands SoilMGPQRLFGMTPWVRRLIVANLVVFLLQVTLFVNPAFLATL
Ga0134076_1053412313300012976Grasslands SoilMNEDLMGPPRMYGFTPWVRRLLVANLIVFLFQVTLFTLQSSANTFGFI
Ga0134075_1003491013300014154Grasslands SoilMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVF
Ga0137420_128153813300015054Vadose Zone SoilMNEDLMGPPRMYGFTPWVRRLLVANLIVFLFQVTLFTLQSSANTFGFIPLLAA
Ga0173480_1110676823300015200SoilMGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVAAFGFD
Ga0137409_1009133613300015245Vadose Zone SoilMGPQRMYGLTPWVRRLLVANLLVFLVQNTLFVDGTLTKALAFAPVDAWKQ
Ga0134085_1005836513300015359Grasslands SoilMGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSF
Ga0134069_132782423300017654Grasslands SoilMDPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGFIG
Ga0134074_109295013300017657Grasslands SoilMGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSPSFVGAFGFS
Ga0134074_131118413300017657Grasslands SoilMGPQRMYGLTPWVRRLLVANLLVFLLQVTLFTSPGFVKA
Ga0134083_1011309613300017659Grasslands SoilMEAQRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQ
Ga0184633_1030319623300018077Groundwater SedimentMDPQRMFGMTPWVRRLLVANLLVFLCQQTVLVDPRFQAVFGFQPLF
Ga0184612_1052454213300018078Groundwater SedimentMMTEDLMGPPRMYVLTPWVRRLLVANLIVFLFQVTLFT
Ga0066667_1092772623300018433Grasslands SoilVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQ
Ga0066662_1002649053300018468Grasslands SoilVGDDLALGPPRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFGFTP
Ga0066662_1049572613300018468Grasslands SoilVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQA
Ga0066669_1011711613300018482Grasslands SoilMGPQRMFGMTPWVRRLFVANLVVFLFQMTIFVDPR
Ga0193705_107375613300019869SoilMMTEDTLGPQRMYVLTPWVRRLLVANLIVFLFQVTLLTLQGSIET
Ga0193745_113537523300020059SoilMDPQRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQ
Ga0215015_1048469013300021046SoilMGPQRMFGMTPWVGRLIVANLIVFLLQMTIFVNPWFVATFGFTPLDA
Ga0179596_1065977313300021086Vadose Zone SoilMDSQRMFGMTTWVRRLLVANLLVFLCQKTVLVDPRFQA
Ga0193699_1003045433300021363SoilMDPQRMFGMTPWVRRLLVANLVVFLCQKTVLVDPR
Ga0193695_100864013300021418SoilMGPQRMYGLSPWVRRLLVANLLVFLVQNTLFATNPDFAKAFAFSPLVAWNQP
Ga0242655_1030190823300022532SoilMDPQRVFGTTPWVRRLLVACLLVFLCQKTVLVDPRFQALFGFQPYYALSR
Ga0247678_105001723300024325SoilMGPQRMYSLTVWVRRLLVANLLVFLIQKTLLIDPKYVAAFAFDPMLAW
Ga0207653_1010746123300025885Corn, Switchgrass And Miscanthus RhizosphereMGPQRMYGLTPWVRRLLVANLLVFLVQNTLFATNPDFATLFPFNPMLA
Ga0207653_1022739613300025885Corn, Switchgrass And Miscanthus RhizosphereMGPQRMYGLTLWVRRLLVANLLVFLVQSTLFTSPSFLKALGFDPMSASR
Ga0209236_102010613300026298Grasslands SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDP
Ga0209761_100239813300026313Grasslands SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLF
Ga0209471_119045023300026318SoilMGPQRMYGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFG
Ga0209266_109172813300026327SoilMDTPRVFGMTPWVRRLFAANLLVFVLQETVLGPRFLAAFGFAPMK
Ga0209803_103036413300026332SoilMGPQRTFGMTPWVRRLMVANLVVFLLQETIFVSPRFIATF
Ga0209160_118514823300026532SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQA
Ga0209376_121432423300026540SoilMDPQRMFGMTPWVRRLIVANLVVFLLQVTLFVSPGF
Ga0209805_117838523300026542SoilMGPQRLFGMTPWVRRLIVANLVVFLLQVTLFVNPAFLATLG
Ga0209161_1018970813300026548SoilVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDP
Ga0209474_1060405323300026550SoilMGPQRMYGLTLWVRRLLVANLLVFLIQKTVLIDPSYLRA
Ga0209689_134907313300027748SoilMGPQRMFGLSLWVRRLLVANLLVFLIQKTLLVDPNFLKAFGFAPL
Ga0209701_1002530313300027862Vadose Zone SoilVGDDLVMGPQRMFGMTPWVRRLLVANLLVYLLQRTLFVDPRFQAVFG
Ga0209488_1123653213300027903Vadose Zone SoilMGPQRMYGLTPWVRRLLVANLLVFLVQSTLLTSPSF
Ga0137415_1141515023300028536Vadose Zone SoilMGPQRMYGLTLWVRRLLVANLLVFLVQNTLFATNPDFAKAFAFTPLTAW
Ga0308194_1031610623300031421SoilMGPQRMYGLTPWVRRLLVANLLVFLIQSTLLTSASFADALAFV
Ga0307469_1086454713300031720Hardwood Forest SoilMDPQRMFGMTPWVRRLLVANLLVFLCQKTVLVDPRFQAVFG
Ga0307471_10165273813300032180Hardwood Forest SoilMGPQRMFGMTPWVWRLIVANLVVFLLQVTLFVSPAFLATF
Ga0214471_1013547613300033417SoilMGPQRMYGLTLWVRRLLVANLLVFLIQSTLLTDPGFLKAFGF
Ga0364934_0242829_1_1053300034178SedimentMMTEDLLGPPRMYALTPWVRRLLVANLIVFRFQAT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.