| Basic Information | |
|---|---|
| Family ID | F091689 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LVSLAATIAGLCSFVPALFVEAFRQFYFAIIHREESY |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 96.26 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.757 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.252 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.813 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00119 | ATP-synt_A | 77.57 |
| PF02606 | LpxK | 1.87 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 77.57 |
| COG1663 | Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase) | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107212926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300000955|JGI1027J12803_109280834 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300002908|JGI25382J43887_10406612 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300002915|JGI25387J43893_1058511 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004643|Ga0062591_101175726 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005336|Ga0070680_100952589 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005353|Ga0070669_100608031 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005354|Ga0070675_100202969 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300005440|Ga0070705_100998951 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005445|Ga0070708_100880298 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005467|Ga0070706_101335586 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005468|Ga0070707_101463277 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005468|Ga0070707_101597237 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005471|Ga0070698_100502047 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005471|Ga0070698_100986421 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005544|Ga0070686_100296894 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005547|Ga0070693_100237383 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300005549|Ga0070704_101235582 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005549|Ga0070704_101785295 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005561|Ga0066699_10736674 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005566|Ga0066693_10253159 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005617|Ga0068859_100237128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1913 | Open in IMG/M |
| 3300005617|Ga0068859_101398407 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005841|Ga0068863_102427647 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005844|Ga0068862_101502927 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005844|Ga0068862_102274073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300006032|Ga0066696_10351309 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300006796|Ga0066665_11424414 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006797|Ga0066659_10226909 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300006800|Ga0066660_11605547 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006871|Ga0075434_101488472 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006881|Ga0068865_101328566 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300007255|Ga0099791_10647410 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009038|Ga0099829_11795128 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009147|Ga0114129_11292973 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300009148|Ga0105243_10912200 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300009156|Ga0111538_13845429 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009157|Ga0105092_10606273 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009176|Ga0105242_12993505 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010039|Ga0126309_10792613 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010046|Ga0126384_10438557 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300010046|Ga0126384_10602693 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300010322|Ga0134084_10317505 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300010326|Ga0134065_10474647 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010337|Ga0134062_10702141 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010398|Ga0126383_10783801 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300010399|Ga0134127_10026093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4605 | Open in IMG/M |
| 3300010399|Ga0134127_11136577 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010399|Ga0134127_11374227 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300010400|Ga0134122_10290849 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300010403|Ga0134123_10887081 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300010403|Ga0134123_12591719 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300011269|Ga0137392_10333125 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300011271|Ga0137393_11721296 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012043|Ga0136631_10272075 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012043|Ga0136631_10463793 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012189|Ga0137388_10472789 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300012198|Ga0137364_10113910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1920 | Open in IMG/M |
| 3300012202|Ga0137363_11022619 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012204|Ga0137374_10485770 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012206|Ga0137380_10972333 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012207|Ga0137381_11809666 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012210|Ga0137378_10461772 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300012285|Ga0137370_11021586 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012361|Ga0137360_10867486 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012361|Ga0137360_11093229 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012362|Ga0137361_11604074 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012469|Ga0150984_101170573 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300012469|Ga0150984_111265935 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300012683|Ga0137398_10130056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1617 | Open in IMG/M |
| 3300012685|Ga0137397_10960073 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012957|Ga0164303_10905654 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300013297|Ga0157378_10432034 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300013297|Ga0157378_10821413 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300014157|Ga0134078_10078287 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300015254|Ga0180089_1020882 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300015358|Ga0134089_10571533 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017792|Ga0163161_11510827 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018056|Ga0184623_10244370 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300018061|Ga0184619_10215563 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300018429|Ga0190272_10012318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4240 | Open in IMG/M |
| 3300018429|Ga0190272_11957451 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018429|Ga0190272_12544619 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300018920|Ga0190273_11647665 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300020022|Ga0193733_1094327 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300021445|Ga0182009_10234174 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300025911|Ga0207654_10474283 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300025921|Ga0207652_11683251 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025922|Ga0207646_10674112 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300025931|Ga0207644_11431636 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025942|Ga0207689_11815818 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025961|Ga0207712_10654083 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300026075|Ga0207708_10977510 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300026088|Ga0207641_12177071 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026300|Ga0209027_1193086 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027471|Ga0209995_1063225 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027874|Ga0209465_10033776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2416 | Open in IMG/M |
| 3300027903|Ga0209488_10400892 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300028380|Ga0268265_12233623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300028536|Ga0137415_10821256 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300031740|Ga0307468_100442615 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031740|Ga0307468_100764842 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031740|Ga0307468_101162424 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300031820|Ga0307473_10398323 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300031962|Ga0307479_10787662 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300033513|Ga0316628_100052723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4240 | Open in IMG/M |
| 3300034165|Ga0364942_0085034 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1072129262 | 3300000955 | Soil | IVSLAATIAGLCAFVPALFVEAFRQFYFAIIHREESY* |
| JGI1027J12803_1092808342 | 3300000955 | Soil | VAAFVFAAAYFEIVSLPATLAGLTAFVPALFVEAVREFYLAIIHREESF* |
| JGI25382J43887_104066121 | 3300002908 | Grasslands Soil | AAYKLRLVSLPATIAGLCAFVPALFVEAGRQFXFAIIHREESF* |
| JGI25387J43893_10585112 | 3300002915 | Grasslands Soil | FIISLTVYFAYKLNLIQVAATLAGMCSFVVALFFEAFVQFYFAIVYREES* |
| Ga0062591_1011757262 | 3300004643 | Soil | AYKLRLVSLGATIAGLCSFVVALFAEALREFYLLIVHREETS* |
| Ga0070680_1009525891 | 3300005336 | Corn Rhizosphere | VFAAHKLRIVSLPAMIVGLCSFVPALFVEAFRQFYFAFIIRKESY* |
| Ga0070669_1006080312 | 3300005353 | Switchgrass Rhizosphere | AVLVSYQLDLVSLPATIAGLCSFVVALFVEALREFYFVIIHREETS* |
| Ga0070675_1002029693 | 3300005354 | Miscanthus Rhizosphere | FVVVLGIANLTAVLAGLASFVVALMVEAGREFYFAITHREEMN* |
| Ga0070705_1009989512 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AYQLNVVSLAATIIGLCSFVPALMFEAFRQFYFIIIHREESI* |
| Ga0070708_1008802982 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GLVVFAAHKLRIVSLPAMIVGLCSFVPALFVEAFRQFYFAFVLRKESY* |
| Ga0070706_1013355861 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AAYQLQIVSLPATIAGLCSFVPALFAEAGREFYLAIIRREESY* |
| Ga0070707_1014632771 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLVALAATIVGLCSFVPALFVEAFRQFYLAIIHREGTY* |
| Ga0070707_1015972371 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GFAVFAAYELHIISLPATIAGLCSFVVALFVEAFRQFYFAIIRREESF* |
| Ga0070698_1005020471 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLVSLAATIVGLCSFVPALFIEAGRQFYRAIIRREEVD* |
| Ga0070698_1009864211 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLVSLPAMFAGLGSFVPALFVEAFRQFYYAFIRREESC* |
| Ga0070686_1002968942 | 3300005544 | Switchgrass Rhizosphere | LQMVSLAATLAGLCAFVPALFVEAVREFYFAIMHREGSF* |
| Ga0070693_1002373831 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | FGLASTPAVIAGLCSFVFALFVEAFREFYFAIIHREEII* |
| Ga0070704_1012355821 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LISYQLDLVSLPATIAGLCSFVVALFVEALREFYSVIIHREETS* |
| Ga0070704_1017852952 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AANLQVVSLAATLAGLCAFVPALFVEAVREFYFAIIHREESF* |
| Ga0066699_107366741 | 3300005561 | Soil | AYKLHLVSLPATLMGLCSFVPALFAEAARQFYFAIIHREESF* |
| Ga0066693_102531591 | 3300005566 | Soil | VVALAATLAGLCSLVPALFVEAARQFYFSIIHREESF* |
| Ga0068859_1002371284 | 3300005617 | Switchgrass Rhizosphere | GGVVLAAYALNIISLPETIAGLCSFVVALFVEAIRQFYFAIIRREESF* |
| Ga0068859_1013984071 | 3300005617 | Switchgrass Rhizosphere | VAYKLRLVSLGATIAGLCSFVVALFAEALREFYLLIVHREETS* |
| Ga0068863_1024276471 | 3300005841 | Switchgrass Rhizosphere | VSLPATLGGLSAFVPALFVEAVREFYFAIIHREESF* |
| Ga0068862_1015029272 | 3300005844 | Switchgrass Rhizosphere | YKLGLVSLGATIAGLCSFVPALFVEALREFYLAIVHREETN* |
| Ga0068862_1022740731 | 3300005844 | Switchgrass Rhizosphere | VYFVVVLGIANLTAVLAGLASFVVALMVEAGREFYFAITHREEMN* |
| Ga0066696_103513091 | 3300006032 | Soil | FAAYKLRLVSLPATIVGLCAFVPALFVEAGRQFYFAISHREESY* |
| Ga0066665_114244141 | 3300006796 | Soil | GYLLQWVSLPATIVGLCAFVPALFVEAFRQFYFAIIHREGSY* |
| Ga0066659_102269093 | 3300006797 | Soil | VTVFAAYKLRLISFVATLLGLCSFVPALFVEAARQFYFAIIHREDSF* |
| Ga0066660_116055472 | 3300006800 | Soil | AYQLHLISLVATLLGLCSLVPALFVEAARQFYFAIIHREESF* |
| Ga0075434_1014884721 | 3300006871 | Populus Rhizosphere | LISLAATIIGLSSFVVALFAEAFRESYFIITHREGIN* |
| Ga0068865_1013285662 | 3300006881 | Miscanthus Rhizosphere | VLAATNLGIVSLAATLAGLCSFVPALFVEAIREFYLAIIHREEPF* |
| Ga0099791_106474102 | 3300007255 | Vadose Zone Soil | RIASLPAIIGGLCTFVVALFAEALREFYFVIIQREGIN* |
| Ga0099829_117951281 | 3300009038 | Vadose Zone Soil | LKIVSLPATFAGLCSFVPALFVEALRQFYFAIIHREESY* |
| Ga0114129_112929731 | 3300009147 | Populus Rhizosphere | FASLAAIIIGLCTFVIALFVEAFREFYFAIIRREEIG* |
| Ga0105243_109122001 | 3300009148 | Miscanthus Rhizosphere | AVVYFAYKLKLVSLGATIAGLCSFVPALFVEALREFYLAIVHREETN* |
| Ga0111538_138454292 | 3300009156 | Populus Rhizosphere | GAYKSGWVSLPATLAGMCSFVAALFVEAFRQFYFVIIGREESF* |
| Ga0105092_106062731 | 3300009157 | Freshwater Sediment | ASLPAMIAGLCTFVVALFVEAIREMYFAIFQREEIS* |
| Ga0105242_129935051 | 3300009176 | Miscanthus Rhizosphere | QLDLVSLPATIAGLCSFVVALFVEALREFYSVIIHREETS* |
| Ga0126309_107926132 | 3300010039 | Serpentine Soil | VFAGYQLNLISLAATIAGLCSFVPALFVEAGRQFYFAIIRGEESF* |
| Ga0126384_104385572 | 3300010046 | Tropical Forest Soil | VSLAATIAGLCSFVPALFVEALRQFYFAIIHREESY* |
| Ga0126384_106026931 | 3300010046 | Tropical Forest Soil | LVSLPATIGGLCSFVVALFVEAMRQFYFAVINREETD* |
| Ga0134084_103175051 | 3300010322 | Grasslands Soil | KLRLVSLPATILGLCAFVPALFVEAGRQFYFAIVHREESF* |
| Ga0134065_104746472 | 3300010326 | Grasslands Soil | LNVVSLAATIVGLCSFVPALMLEAFRQFYFIIIHREESI* |
| Ga0134062_107021412 | 3300010337 | Grasslands Soil | TVFAAYKLHLVSLVATLLGLCSFVPALFVEAARQFYFAIIHREESF* |
| Ga0126383_107838012 | 3300010398 | Tropical Forest Soil | VVSLPATIVGLCSFVVALFAEAFRQSYFSIVNREGIN* |
| Ga0134127_100260936 | 3300010399 | Terrestrial Soil | LPATLAGLCSFVAALFVEAFRQFYFAIIRGEESF* |
| Ga0134127_111365772 | 3300010399 | Terrestrial Soil | FIANKLKIVSLPATIAGLCAFVPALMIEAFRQFYFAFILRKESS* |
| Ga0134127_113742272 | 3300010399 | Terrestrial Soil | AVFAGYQLNLISLAATIAGLCSFVPALFVEAGRQFYFAIIRREESF* |
| Ga0134122_102908491 | 3300010400 | Terrestrial Soil | NLVSLVATIAGLSSFVAALFVEAFREFYFVIIHREETS* |
| Ga0134123_108870812 | 3300010403 | Terrestrial Soil | SIPALIAGLCSFVFALFVEAFREFYFAIIHREEII* |
| Ga0134123_125917192 | 3300010403 | Terrestrial Soil | VNLQIVSLAATLAGLSAFVPALFVEALREFYLAIIHREESV* |
| Ga0137392_103331251 | 3300011269 | Vadose Zone Soil | FVAFAGYKIKLVSLPALFAGLSSFVPAIFVEAGRQFYLVIIRREESY* |
| Ga0137393_117212962 | 3300011271 | Vadose Zone Soil | YAAYESGLISLPAMFAGLCSFVPALFVEAFRQFYFAIIRREESI* |
| Ga0136631_102720752 | 3300012043 | Polar Desert Sand | AYKLGVVSLIATIIGLCSFVVALFVEAFKEFYIAIIHGEEIS* |
| Ga0136631_104637932 | 3300012043 | Polar Desert Sand | VVAAVVWAAYALDLVSLPATIVGLCAFVPALLIEALTQFYFAIVYREDT* |
| Ga0137388_104727892 | 3300012189 | Vadose Zone Soil | SLPALFAGLSSFVPAIFVEAGRQFYLVVIRREESY* |
| Ga0137364_101139103 | 3300012198 | Vadose Zone Soil | LTATIAGLCSFVVALFLEAFREFYFAIIHREEIS* |
| Ga0137363_110226192 | 3300012202 | Vadose Zone Soil | SLPAMFAGLCSFVPAVFVEAFRQFYFAIIRREESF* |
| Ga0137374_104857702 | 3300012204 | Vadose Zone Soil | SLAATIAGLCSFVVALFVEAFREFYFAIIHREETN* |
| Ga0137380_109723332 | 3300012206 | Vadose Zone Soil | YRLNVVSLAATIAGLCAFVAAMFGEAGRSFYLMMFHREEY* |
| Ga0137381_118096662 | 3300012207 | Vadose Zone Soil | AAYELRLVSLGAMFAGLCSFVPALFIEASRQFYFAIIRREESF* |
| Ga0137378_104617721 | 3300012210 | Vadose Zone Soil | KLRMASLPAVLAGLCSFVVALFAEAVREFYFVIMHREETS* |
| Ga0137370_110215861 | 3300012285 | Vadose Zone Soil | AYQLRIVSLPATIIGLSAFVPALFVEALRQFYFSIIHREGTY* |
| Ga0137360_108674861 | 3300012361 | Vadose Zone Soil | KLHLVALAATLAGLCSLVPALFVEAARQFYFSIIHREESF* |
| Ga0137360_110932291 | 3300012361 | Vadose Zone Soil | VSLPAVFAGLCSFVPAVFVEAFRQFYFAIIRREESF* |
| Ga0137361_116040742 | 3300012362 | Vadose Zone Soil | RLVSLGAMFAGLCSFVPALFIEALRQFYFAIIRREESF* |
| Ga0150984_1011705734 | 3300012469 | Avena Fatua Rhizosphere | SLPATLGGLSAFVPALFVEAVREFYFAIIHREESF* |
| Ga0150984_1112659352 | 3300012469 | Avena Fatua Rhizosphere | WKLNLVSLAATIFGLCSFVAGLFSEAFRQIYFTMLSREEPN* |
| Ga0137398_101300563 | 3300012683 | Vadose Zone Soil | GATAYAAYKLGLVSLAAMFAGLCAFVPALFVEAFRQFYFAIIRREESF* |
| Ga0137397_109600731 | 3300012685 | Vadose Zone Soil | IASLPAIIGGLCTFVVALFAEALREFYFVIIQREGVN* |
| Ga0164303_109056541 | 3300012957 | Soil | VPAAIAGLCSFVVALFVEAFRQFYFAIIRREESF* |
| Ga0157378_104320341 | 3300013297 | Miscanthus Rhizosphere | LVFIAYKLNIVSLAATIAGLCSFVVALFAEAFREFYFVIIHREETS* |
| Ga0157378_108214131 | 3300013297 | Miscanthus Rhizosphere | FGLASIPAVIAGLCSFVFALFIEAFREFYFAIIHREEII* |
| Ga0134078_100782872 | 3300014157 | Grasslands Soil | AAYKLNVVSLPATIVGLCSFVIALFAEACRQFYFIIVNREGIN* |
| Ga0180089_10208822 | 3300015254 | Soil | VSLAATIAGLSSFVVALFVEALREFYFVIIHREETS* |
| Ga0134089_105715332 | 3300015358 | Grasslands Soil | GVISFAAYKLRLVSLPATIAGLCAFVPALFVEAGRQFYFAIIHREESF* |
| Ga0163161_115108271 | 3300017792 | Switchgrass Rhizosphere | NLISVPATIAGLCSFVVALFVEAFRQFYFAIIRREESF |
| Ga0184623_102443701 | 3300018056 | Groundwater Sediment | KLKIVSLPAMIIGLCSFVPALFVEALRQFYFAFVLRKESY |
| Ga0184619_102155631 | 3300018061 | Groundwater Sediment | YKLNIVSLTATIIGLCSFVAALFVEAFREFYFVIVHREEIS |
| Ga0190272_100123181 | 3300018429 | Soil | AVSLPATLIGLCSFVAAIFVEAFREFYFAFIQREEIN |
| Ga0190272_119574512 | 3300018429 | Soil | NIVSLAATLIGLCSFVAAIFVEAFREFYFAFIQREEIN |
| Ga0190272_125446191 | 3300018429 | Soil | KLNVISLAAVLAGLATFVVALFVEAFRAFYFAIIQREEIS |
| Ga0190273_116476651 | 3300018920 | Soil | VVAYKLNIVSLTATIVGLCSFVVALFAEALRESYLAIIHREEIS |
| Ga0193733_10943272 | 3300020022 | Soil | YKLNVVSLPATIIGLCSFVVALFAEAFRQIYFIIVNREGIN |
| Ga0182009_102341742 | 3300021445 | Soil | NIISLPATIAGLCSFVAALFVEAFRQFYFAIIRREESF |
| Ga0207654_104742832 | 3300025911 | Corn Rhizosphere | AYALNIISLPATIAGLCSFVVALFVEAIRQFYFAIIRREESF |
| Ga0207652_116832512 | 3300025921 | Corn Rhizosphere | TLVFTAYKLNIVSLAATIAGLCSFVVALFVEALREIYFVIIHREETS |
| Ga0207646_106741122 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLVALAATIVGLCSFVPALFVEAFRQFYLAIIHREGTY |
| Ga0207644_114316361 | 3300025931 | Switchgrass Rhizosphere | VSLGATIAGLCSFVPALFVEALREFYLAIVHREETN |
| Ga0207689_118158182 | 3300025942 | Miscanthus Rhizosphere | FGLASIPAVIAGLCSFVFALFVEAFREFYFAIIHREEII |
| Ga0207712_106540831 | 3300025961 | Switchgrass Rhizosphere | LAYKLNIVSLTATIVGLCSFVAALLVEALRQSYFAIIHREEII |
| Ga0207708_109775101 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | YKLNLVSLPATIFGLCSFVVGLFAEAFRQFYFIIIHREGIN |
| Ga0207641_121770711 | 3300026088 | Switchgrass Rhizosphere | VVLLAYELRIVSLAATIAGLCAFVPALFVEAFRQFYFAIIHREESF |
| Ga0209027_11930861 | 3300026300 | Grasslands Soil | FVSYKLRLASLPAAIVGLCSFVAALFVEAFRQFYFAIIRREESF |
| Ga0209995_10632251 | 3300027471 | Arabidopsis Thaliana Rhizosphere | FNLVSLSATMAGLCSFVVALFVEALRAFYFVIIQREETS |
| Ga0209465_100337764 | 3300027874 | Tropical Forest Soil | LVSLAATIAGLCSFVPALFVEAFRQFYFAIIHREESY |
| Ga0209488_104008921 | 3300027903 | Vadose Zone Soil | AVAAYELRLVSLPALLVGLCSFVPALFVEAFRQFYFAIIRREESF |
| Ga0268265_122336231 | 3300028380 | Switchgrass Rhizosphere | VYFVVVLGIANLTAVLAGLASFVVALMVEAGREFYFAITHREEMN |
| Ga0137415_108212562 | 3300028536 | Vadose Zone Soil | GIVSLAATIIGLCSFVIALFAEAIREFYFAIIHREGIN |
| Ga0307468_1004426152 | 3300031740 | Hardwood Forest Soil | LISLPATIAGLCSFVVALFVEAFRQFYFAIIRREESF |
| Ga0307468_1007648422 | 3300031740 | Hardwood Forest Soil | RFDVVSLTATVAGLSSFVVALFAEALRESYFIFIHREEIH |
| Ga0307468_1011624242 | 3300031740 | Hardwood Forest Soil | LNLVSLAATIAGLSSFVVALFVEALREFYFVIIHREETS |
| Ga0307473_103983232 | 3300031820 | Hardwood Forest Soil | AYQLGLVSLPATIMGLCSFVVALFAEAFRQFYIVIIRREEVS |
| Ga0307479_107876622 | 3300031962 | Hardwood Forest Soil | GYAVYKLGVVSLPAMFAGLCSFVPALFVEAFRQFYFAIIRREESF |
| Ga0316628_1000527231 | 3300033513 | Soil | RIASLPALFAGLCSFVVALFFEASREFYFAITHGEETN |
| Ga0364942_0085034_3_128 | 3300034165 | Sediment | YKFNIVSLTATIAGLCSFVAALFVEAFREFYFAIIRREETS |
| ⦗Top⦘ |