NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091689

Metagenome Family F091689

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091689
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 41 residues
Representative Sequence LVSLAATIAGLCSFVPALFVEAFRQFYFAIIHREESY
Number of Associated Samples 89
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 96.26 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.757 % of family members)
Environment Ontology (ENVO) Unclassified
(39.252 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.813 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.85%    β-sheet: 0.00%    Coil/Unstructured: 46.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00119ATP-synt_A 77.57
PF02606LpxK 1.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 77.57
COG1663Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase)Cell wall/membrane/envelope biogenesis [M] 1.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_107212926All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300000955|JGI1027J12803_109280834All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300002908|JGI25382J43887_10406612All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300002915|JGI25387J43893_1058511All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300004643|Ga0062591_101175726All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005336|Ga0070680_100952589All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005353|Ga0070669_100608031All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300005354|Ga0070675_100202969All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300005440|Ga0070705_100998951All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005445|Ga0070708_100880298All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300005467|Ga0070706_101335586All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005468|Ga0070707_101463277All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005468|Ga0070707_101597237All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005471|Ga0070698_100502047All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300005471|Ga0070698_100986421All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005544|Ga0070686_100296894All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300005547|Ga0070693_100237383All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300005549|Ga0070704_101235582All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005549|Ga0070704_101785295All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005561|Ga0066699_10736674All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005566|Ga0066693_10253159All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005617|Ga0068859_100237128All Organisms → cellular organisms → Bacteria → Acidobacteria1913Open in IMG/M
3300005617|Ga0068859_101398407All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005841|Ga0068863_102427647All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005844|Ga0068862_101502927All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005844|Ga0068862_102274073All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300006032|Ga0066696_10351309All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300006796|Ga0066665_11424414All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006797|Ga0066659_10226909All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300006800|Ga0066660_11605547All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006871|Ga0075434_101488472All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006881|Ga0068865_101328566All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300007255|Ga0099791_10647410All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300009038|Ga0099829_11795128All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009147|Ga0114129_11292973All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300009148|Ga0105243_10912200All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300009156|Ga0111538_13845429All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009157|Ga0105092_10606273All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300009176|Ga0105242_12993505All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010039|Ga0126309_10792613All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300010046|Ga0126384_10438557All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300010046|Ga0126384_10602693All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300010322|Ga0134084_10317505All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300010326|Ga0134065_10474647All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010337|Ga0134062_10702141All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010398|Ga0126383_10783801All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300010399|Ga0134127_10026093All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4605Open in IMG/M
3300010399|Ga0134127_11136577All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300010399|Ga0134127_11374227All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300010400|Ga0134122_10290849All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300010403|Ga0134123_10887081All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300010403|Ga0134123_12591719All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300011269|Ga0137392_10333125All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300011271|Ga0137393_11721296All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012043|Ga0136631_10272075All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300012043|Ga0136631_10463793All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300012189|Ga0137388_10472789All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300012198|Ga0137364_10113910All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1920Open in IMG/M
3300012202|Ga0137363_11022619All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300012204|Ga0137374_10485770All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300012206|Ga0137380_10972333All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300012207|Ga0137381_11809666All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012210|Ga0137378_10461772All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300012285|Ga0137370_11021586All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012361|Ga0137360_10867486All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300012361|Ga0137360_11093229All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012362|Ga0137361_11604074All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012469|Ga0150984_101170573All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300012469|Ga0150984_111265935All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300012683|Ga0137398_10130056All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1617Open in IMG/M
3300012685|Ga0137397_10960073All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300012957|Ga0164303_10905654All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300013297|Ga0157378_10432034All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300013297|Ga0157378_10821413All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300014157|Ga0134078_10078287All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300015254|Ga0180089_1020882All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300015358|Ga0134089_10571533All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300017792|Ga0163161_11510827All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300018056|Ga0184623_10244370All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300018061|Ga0184619_10215563All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300018429|Ga0190272_10012318All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4240Open in IMG/M
3300018429|Ga0190272_11957451All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300018429|Ga0190272_12544619All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300018920|Ga0190273_11647665All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300020022|Ga0193733_1094327All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300021445|Ga0182009_10234174All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300025911|Ga0207654_10474283All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300025921|Ga0207652_11683251All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025922|Ga0207646_10674112All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300025931|Ga0207644_11431636All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025942|Ga0207689_11815818All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025961|Ga0207712_10654083All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300026075|Ga0207708_10977510All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300026088|Ga0207641_12177071All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300026300|Ga0209027_1193086All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300027471|Ga0209995_1063225All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300027874|Ga0209465_10033776All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2416Open in IMG/M
3300027903|Ga0209488_10400892All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300028380|Ga0268265_12233623All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300028536|Ga0137415_10821256All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031740|Ga0307468_100442615All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300031740|Ga0307468_100764842All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300031740|Ga0307468_101162424All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300031820|Ga0307473_10398323All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300031962|Ga0307479_10787662All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300033513|Ga0316628_100052723All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4240Open in IMG/M
3300034165|Ga0364942_0085034All Organisms → cellular organisms → Bacteria1020Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.93%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10721292623300000955SoilIVSLAATIAGLCAFVPALFVEAFRQFYFAIIHREESY*
JGI1027J12803_10928083423300000955SoilVAAFVFAAAYFEIVSLPATLAGLTAFVPALFVEAVREFYLAIIHREESF*
JGI25382J43887_1040661213300002908Grasslands SoilAAYKLRLVSLPATIAGLCAFVPALFVEAGRQFXFAIIHREESF*
JGI25387J43893_105851123300002915Grasslands SoilFIISLTVYFAYKLNLIQVAATLAGMCSFVVALFFEAFVQFYFAIVYREES*
Ga0062591_10117572623300004643SoilAYKLRLVSLGATIAGLCSFVVALFAEALREFYLLIVHREETS*
Ga0070680_10095258913300005336Corn RhizosphereVFAAHKLRIVSLPAMIVGLCSFVPALFVEAFRQFYFAFIIRKESY*
Ga0070669_10060803123300005353Switchgrass RhizosphereAVLVSYQLDLVSLPATIAGLCSFVVALFVEALREFYFVIIHREETS*
Ga0070675_10020296933300005354Miscanthus RhizosphereFVVVLGIANLTAVLAGLASFVVALMVEAGREFYFAITHREEMN*
Ga0070705_10099895123300005440Corn, Switchgrass And Miscanthus RhizosphereAYQLNVVSLAATIIGLCSFVPALMFEAFRQFYFIIIHREESI*
Ga0070708_10088029823300005445Corn, Switchgrass And Miscanthus RhizosphereGLVVFAAHKLRIVSLPAMIVGLCSFVPALFVEAFRQFYFAFVLRKESY*
Ga0070706_10133558613300005467Corn, Switchgrass And Miscanthus RhizosphereAAYQLQIVSLPATIAGLCSFVPALFAEAGREFYLAIIRREESY*
Ga0070707_10146327713300005468Corn, Switchgrass And Miscanthus RhizosphereLQLVALAATIVGLCSFVPALFVEAFRQFYLAIIHREGTY*
Ga0070707_10159723713300005468Corn, Switchgrass And Miscanthus RhizosphereGFAVFAAYELHIISLPATIAGLCSFVVALFVEAFRQFYFAIIRREESF*
Ga0070698_10050204713300005471Corn, Switchgrass And Miscanthus RhizosphereLQLVSLAATIVGLCSFVPALFIEAGRQFYRAIIRREEVD*
Ga0070698_10098642113300005471Corn, Switchgrass And Miscanthus RhizosphereLGLVSLPAMFAGLGSFVPALFVEAFRQFYYAFIRREESC*
Ga0070686_10029689423300005544Switchgrass RhizosphereLQMVSLAATLAGLCAFVPALFVEAVREFYFAIMHREGSF*
Ga0070693_10023738313300005547Corn, Switchgrass And Miscanthus RhizosphereFGLASTPAVIAGLCSFVFALFVEAFREFYFAIIHREEII*
Ga0070704_10123558213300005549Corn, Switchgrass And Miscanthus RhizosphereLISYQLDLVSLPATIAGLCSFVVALFVEALREFYSVIIHREETS*
Ga0070704_10178529523300005549Corn, Switchgrass And Miscanthus RhizosphereAANLQVVSLAATLAGLCAFVPALFVEAVREFYFAIIHREESF*
Ga0066699_1073667413300005561SoilAYKLHLVSLPATLMGLCSFVPALFAEAARQFYFAIIHREESF*
Ga0066693_1025315913300005566SoilVVALAATLAGLCSLVPALFVEAARQFYFSIIHREESF*
Ga0068859_10023712843300005617Switchgrass RhizosphereGGVVLAAYALNIISLPETIAGLCSFVVALFVEAIRQFYFAIIRREESF*
Ga0068859_10139840713300005617Switchgrass RhizosphereVAYKLRLVSLGATIAGLCSFVVALFAEALREFYLLIVHREETS*
Ga0068863_10242764713300005841Switchgrass RhizosphereVSLPATLGGLSAFVPALFVEAVREFYFAIIHREESF*
Ga0068862_10150292723300005844Switchgrass RhizosphereYKLGLVSLGATIAGLCSFVPALFVEALREFYLAIVHREETN*
Ga0068862_10227407313300005844Switchgrass RhizosphereVYFVVVLGIANLTAVLAGLASFVVALMVEAGREFYFAITHREEMN*
Ga0066696_1035130913300006032SoilFAAYKLRLVSLPATIVGLCAFVPALFVEAGRQFYFAISHREESY*
Ga0066665_1142441413300006796SoilGYLLQWVSLPATIVGLCAFVPALFVEAFRQFYFAIIHREGSY*
Ga0066659_1022690933300006797SoilVTVFAAYKLRLISFVATLLGLCSFVPALFVEAARQFYFAIIHREDSF*
Ga0066660_1160554723300006800SoilAYQLHLISLVATLLGLCSLVPALFVEAARQFYFAIIHREESF*
Ga0075434_10148847213300006871Populus RhizosphereLISLAATIIGLSSFVVALFAEAFRESYFIITHREGIN*
Ga0068865_10132856623300006881Miscanthus RhizosphereVLAATNLGIVSLAATLAGLCSFVPALFVEAIREFYLAIIHREEPF*
Ga0099791_1064741023300007255Vadose Zone SoilRIASLPAIIGGLCTFVVALFAEALREFYFVIIQREGIN*
Ga0099829_1179512813300009038Vadose Zone SoilLKIVSLPATFAGLCSFVPALFVEALRQFYFAIIHREESY*
Ga0114129_1129297313300009147Populus RhizosphereFASLAAIIIGLCTFVIALFVEAFREFYFAIIRREEIG*
Ga0105243_1091220013300009148Miscanthus RhizosphereAVVYFAYKLKLVSLGATIAGLCSFVPALFVEALREFYLAIVHREETN*
Ga0111538_1384542923300009156Populus RhizosphereGAYKSGWVSLPATLAGMCSFVAALFVEAFRQFYFVIIGREESF*
Ga0105092_1060627313300009157Freshwater SedimentASLPAMIAGLCTFVVALFVEAIREMYFAIFQREEIS*
Ga0105242_1299350513300009176Miscanthus RhizosphereQLDLVSLPATIAGLCSFVVALFVEALREFYSVIIHREETS*
Ga0126309_1079261323300010039Serpentine SoilVFAGYQLNLISLAATIAGLCSFVPALFVEAGRQFYFAIIRGEESF*
Ga0126384_1043855723300010046Tropical Forest SoilVSLAATIAGLCSFVPALFVEALRQFYFAIIHREESY*
Ga0126384_1060269313300010046Tropical Forest SoilLVSLPATIGGLCSFVVALFVEAMRQFYFAVINREETD*
Ga0134084_1031750513300010322Grasslands SoilKLRLVSLPATILGLCAFVPALFVEAGRQFYFAIVHREESF*
Ga0134065_1047464723300010326Grasslands SoilLNVVSLAATIVGLCSFVPALMLEAFRQFYFIIIHREESI*
Ga0134062_1070214123300010337Grasslands SoilTVFAAYKLHLVSLVATLLGLCSFVPALFVEAARQFYFAIIHREESF*
Ga0126383_1078380123300010398Tropical Forest SoilVVSLPATIVGLCSFVVALFAEAFRQSYFSIVNREGIN*
Ga0134127_1002609363300010399Terrestrial SoilLPATLAGLCSFVAALFVEAFRQFYFAIIRGEESF*
Ga0134127_1113657723300010399Terrestrial SoilFIANKLKIVSLPATIAGLCAFVPALMIEAFRQFYFAFILRKESS*
Ga0134127_1137422723300010399Terrestrial SoilAVFAGYQLNLISLAATIAGLCSFVPALFVEAGRQFYFAIIRREESF*
Ga0134122_1029084913300010400Terrestrial SoilNLVSLVATIAGLSSFVAALFVEAFREFYFVIIHREETS*
Ga0134123_1088708123300010403Terrestrial SoilSIPALIAGLCSFVFALFVEAFREFYFAIIHREEII*
Ga0134123_1259171923300010403Terrestrial SoilVNLQIVSLAATLAGLSAFVPALFVEALREFYLAIIHREESV*
Ga0137392_1033312513300011269Vadose Zone SoilFVAFAGYKIKLVSLPALFAGLSSFVPAIFVEAGRQFYLVIIRREESY*
Ga0137393_1172129623300011271Vadose Zone SoilYAAYESGLISLPAMFAGLCSFVPALFVEAFRQFYFAIIRREESI*
Ga0136631_1027207523300012043Polar Desert SandAYKLGVVSLIATIIGLCSFVVALFVEAFKEFYIAIIHGEEIS*
Ga0136631_1046379323300012043Polar Desert SandVVAAVVWAAYALDLVSLPATIVGLCAFVPALLIEALTQFYFAIVYREDT*
Ga0137388_1047278923300012189Vadose Zone SoilSLPALFAGLSSFVPAIFVEAGRQFYLVVIRREESY*
Ga0137364_1011391033300012198Vadose Zone SoilLTATIAGLCSFVVALFLEAFREFYFAIIHREEIS*
Ga0137363_1102261923300012202Vadose Zone SoilSLPAMFAGLCSFVPAVFVEAFRQFYFAIIRREESF*
Ga0137374_1048577023300012204Vadose Zone SoilSLAATIAGLCSFVVALFVEAFREFYFAIIHREETN*
Ga0137380_1097233323300012206Vadose Zone SoilYRLNVVSLAATIAGLCAFVAAMFGEAGRSFYLMMFHREEY*
Ga0137381_1180966623300012207Vadose Zone SoilAAYELRLVSLGAMFAGLCSFVPALFIEASRQFYFAIIRREESF*
Ga0137378_1046177213300012210Vadose Zone SoilKLRMASLPAVLAGLCSFVVALFAEAVREFYFVIMHREETS*
Ga0137370_1102158613300012285Vadose Zone SoilAYQLRIVSLPATIIGLSAFVPALFVEALRQFYFSIIHREGTY*
Ga0137360_1086748613300012361Vadose Zone SoilKLHLVALAATLAGLCSLVPALFVEAARQFYFSIIHREESF*
Ga0137360_1109322913300012361Vadose Zone SoilVSLPAVFAGLCSFVPAVFVEAFRQFYFAIIRREESF*
Ga0137361_1160407423300012362Vadose Zone SoilRLVSLGAMFAGLCSFVPALFIEALRQFYFAIIRREESF*
Ga0150984_10117057343300012469Avena Fatua RhizosphereSLPATLGGLSAFVPALFVEAVREFYFAIIHREESF*
Ga0150984_11126593523300012469Avena Fatua RhizosphereWKLNLVSLAATIFGLCSFVAGLFSEAFRQIYFTMLSREEPN*
Ga0137398_1013005633300012683Vadose Zone SoilGATAYAAYKLGLVSLAAMFAGLCAFVPALFVEAFRQFYFAIIRREESF*
Ga0137397_1096007313300012685Vadose Zone SoilIASLPAIIGGLCTFVVALFAEALREFYFVIIQREGVN*
Ga0164303_1090565413300012957SoilVPAAIAGLCSFVVALFVEAFRQFYFAIIRREESF*
Ga0157378_1043203413300013297Miscanthus RhizosphereLVFIAYKLNIVSLAATIAGLCSFVVALFAEAFREFYFVIIHREETS*
Ga0157378_1082141313300013297Miscanthus RhizosphereFGLASIPAVIAGLCSFVFALFIEAFREFYFAIIHREEII*
Ga0134078_1007828723300014157Grasslands SoilAAYKLNVVSLPATIVGLCSFVIALFAEACRQFYFIIVNREGIN*
Ga0180089_102088223300015254SoilVSLAATIAGLSSFVVALFVEALREFYFVIIHREETS*
Ga0134089_1057153323300015358Grasslands SoilGVISFAAYKLRLVSLPATIAGLCAFVPALFVEAGRQFYFAIIHREESF*
Ga0163161_1151082713300017792Switchgrass RhizosphereNLISVPATIAGLCSFVVALFVEAFRQFYFAIIRREESF
Ga0184623_1024437013300018056Groundwater SedimentKLKIVSLPAMIIGLCSFVPALFVEALRQFYFAFVLRKESY
Ga0184619_1021556313300018061Groundwater SedimentYKLNIVSLTATIIGLCSFVAALFVEAFREFYFVIVHREEIS
Ga0190272_1001231813300018429SoilAVSLPATLIGLCSFVAAIFVEAFREFYFAFIQREEIN
Ga0190272_1195745123300018429SoilNIVSLAATLIGLCSFVAAIFVEAFREFYFAFIQREEIN
Ga0190272_1254461913300018429SoilKLNVISLAAVLAGLATFVVALFVEAFRAFYFAIIQREEIS
Ga0190273_1164766513300018920SoilVVAYKLNIVSLTATIVGLCSFVVALFAEALRESYLAIIHREEIS
Ga0193733_109432723300020022SoilYKLNVVSLPATIIGLCSFVVALFAEAFRQIYFIIVNREGIN
Ga0182009_1023417423300021445SoilNIISLPATIAGLCSFVAALFVEAFRQFYFAIIRREESF
Ga0207654_1047428323300025911Corn RhizosphereAYALNIISLPATIAGLCSFVVALFVEAIRQFYFAIIRREESF
Ga0207652_1168325123300025921Corn RhizosphereTLVFTAYKLNIVSLAATIAGLCSFVVALFVEALREIYFVIIHREETS
Ga0207646_1067411223300025922Corn, Switchgrass And Miscanthus RhizosphereLQLVALAATIVGLCSFVPALFVEAFRQFYLAIIHREGTY
Ga0207644_1143163613300025931Switchgrass RhizosphereVSLGATIAGLCSFVPALFVEALREFYLAIVHREETN
Ga0207689_1181581823300025942Miscanthus RhizosphereFGLASIPAVIAGLCSFVFALFVEAFREFYFAIIHREEII
Ga0207712_1065408313300025961Switchgrass RhizosphereLAYKLNIVSLTATIVGLCSFVAALLVEALRQSYFAIIHREEII
Ga0207708_1097751013300026075Corn, Switchgrass And Miscanthus RhizosphereYKLNLVSLPATIFGLCSFVVGLFAEAFRQFYFIIIHREGIN
Ga0207641_1217707113300026088Switchgrass RhizosphereVVLLAYELRIVSLAATIAGLCAFVPALFVEAFRQFYFAIIHREESF
Ga0209027_119308613300026300Grasslands SoilFVSYKLRLASLPAAIVGLCSFVAALFVEAFRQFYFAIIRREESF
Ga0209995_106322513300027471Arabidopsis Thaliana RhizosphereFNLVSLSATMAGLCSFVVALFVEALRAFYFVIIQREETS
Ga0209465_1003377643300027874Tropical Forest SoilLVSLAATIAGLCSFVPALFVEAFRQFYFAIIHREESY
Ga0209488_1040089213300027903Vadose Zone SoilAVAAYELRLVSLPALLVGLCSFVPALFVEAFRQFYFAIIRREESF
Ga0268265_1223362313300028380Switchgrass RhizosphereVYFVVVLGIANLTAVLAGLASFVVALMVEAGREFYFAITHREEMN
Ga0137415_1082125623300028536Vadose Zone SoilGIVSLAATIIGLCSFVIALFAEAIREFYFAIIHREGIN
Ga0307468_10044261523300031740Hardwood Forest SoilLISLPATIAGLCSFVVALFVEAFRQFYFAIIRREESF
Ga0307468_10076484223300031740Hardwood Forest SoilRFDVVSLTATVAGLSSFVVALFAEALRESYFIFIHREEIH
Ga0307468_10116242423300031740Hardwood Forest SoilLNLVSLAATIAGLSSFVVALFVEALREFYFVIIHREETS
Ga0307473_1039832323300031820Hardwood Forest SoilAYQLGLVSLPATIMGLCSFVVALFAEAFRQFYIVIIRREEVS
Ga0307479_1078766223300031962Hardwood Forest SoilGYAVYKLGVVSLPAMFAGLCSFVPALFVEAFRQFYFAIIRREESF
Ga0316628_10005272313300033513SoilRIASLPALFAGLCSFVVALFFEASREFYFAITHGEETN
Ga0364942_0085034_3_1283300034165SedimentYKFNIVSLTATIAGLCSFVAALFVEAFREFYFAIIRREETS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.