NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091670

Metagenome / Metatranscriptome Family F091670

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091670
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 48 residues
Representative Sequence AIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Number of Associated Samples 86
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 97.20 %
% of genes from short scaffolds (< 2000 bps) 88.79 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(18.692 % of family members)
Environment Ontology (ENVO) Unclassified
(37.383 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.075 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.89%    β-sheet: 0.00%    Coil/Unstructured: 58.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF02800Gp_dh_C 48.60
PF00044Gp_dh_N 41.12
PF00162PGK 5.61
PF01326PPDK_N 0.93
PF13883Pyrid_oxidase_2 0.93
PF03952Enolase_N 0.93
PF00480ROK 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 89.72
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 5.61
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.87
COG0148EnolaseCarbohydrate transport and metabolism [G] 0.93
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000574|JGI1357J11328_10195065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300000956|JGI10216J12902_100277064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1016Open in IMG/M
3300000956|JGI10216J12902_103028496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium789Open in IMG/M
3300000956|JGI10216J12902_115739967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium799Open in IMG/M
3300001661|JGI12053J15887_10053405All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300002561|JGI25384J37096_10228826All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300002908|JGI25382J43887_10278453All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300004480|Ga0062592_101189480All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005172|Ga0066683_10030243All Organisms → cellular organisms → Bacteria3113Open in IMG/M
3300005293|Ga0065715_10775066All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005364|Ga0070673_100587244All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300005450|Ga0066682_10065288All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300005450|Ga0066682_10869294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium539Open in IMG/M
3300005451|Ga0066681_10335411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium928Open in IMG/M
3300005467|Ga0070706_100036359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4548Open in IMG/M
3300005468|Ga0070707_100549119All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005546|Ga0070696_101533935All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005553|Ga0066695_10664790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi615Open in IMG/M
3300005560|Ga0066670_10174012All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300005568|Ga0066703_10152384All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300005568|Ga0066703_10785072All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005569|Ga0066705_10838241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300005578|Ga0068854_102067143All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005719|Ga0068861_100633531All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300006797|Ga0066659_10521441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi956Open in IMG/M
3300006797|Ga0066659_11402106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium583Open in IMG/M
3300006846|Ga0075430_101420486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium570Open in IMG/M
3300009012|Ga0066710_100203529All Organisms → cellular organisms → Bacteria2820Open in IMG/M
3300009012|Ga0066710_103770228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium569Open in IMG/M
3300009038|Ga0099829_10335367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1243Open in IMG/M
3300009053|Ga0105095_10271836All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300009088|Ga0099830_10783382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium786Open in IMG/M
3300009090|Ga0099827_10601292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium948Open in IMG/M
3300009090|Ga0099827_11215579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium655Open in IMG/M
3300009147|Ga0114129_10676506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1329Open in IMG/M
3300009147|Ga0114129_12868011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300010304|Ga0134088_10042377All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300010329|Ga0134111_10506692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium530Open in IMG/M
3300010335|Ga0134063_10125359All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300010335|Ga0134063_10182736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium982Open in IMG/M
3300012045|Ga0136623_10136612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1065Open in IMG/M
3300012092|Ga0136621_1032291All Organisms → cellular organisms → Bacteria2154Open in IMG/M
3300012184|Ga0136610_1157947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium786Open in IMG/M
3300012198|Ga0137364_10521506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium894Open in IMG/M
3300012198|Ga0137364_10986845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
3300012209|Ga0137379_10864436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium809Open in IMG/M
3300012209|Ga0137379_10872637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium804Open in IMG/M
3300012210|Ga0137378_10427638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1227Open in IMG/M
3300012211|Ga0137377_11396849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium629Open in IMG/M
3300012349|Ga0137387_10380586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1023Open in IMG/M
3300012353|Ga0137367_10964767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium584Open in IMG/M
3300012530|Ga0136635_10071236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1073Open in IMG/M
3300012532|Ga0137373_10412041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1047Open in IMG/M
3300012668|Ga0157216_10018907All Organisms → cellular organisms → Bacteria3618Open in IMG/M
3300012684|Ga0136614_10102354All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300012684|Ga0136614_10168262All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300012917|Ga0137395_11188203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium535Open in IMG/M
3300012972|Ga0134077_10201007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium812Open in IMG/M
3300012972|Ga0134077_10251545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium732Open in IMG/M
3300012972|Ga0134077_10458724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300013770|Ga0120123_1101282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi657Open in IMG/M
3300014745|Ga0157377_11129238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium602Open in IMG/M
3300015241|Ga0137418_10504410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium967Open in IMG/M
3300015358|Ga0134089_10082200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1215Open in IMG/M
3300015359|Ga0134085_10426597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium598Open in IMG/M
3300017654|Ga0134069_1315510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium557Open in IMG/M
3300017656|Ga0134112_10397905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium569Open in IMG/M
3300017789|Ga0136617_10212497All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300017789|Ga0136617_10925587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium664Open in IMG/M
3300018061|Ga0184619_10131045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1138Open in IMG/M
3300018061|Ga0184619_10366677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium656Open in IMG/M
3300018433|Ga0066667_10087916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2026Open in IMG/M
3300018433|Ga0066667_11494942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium597Open in IMG/M
3300018482|Ga0066669_10381873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1185Open in IMG/M
3300019279|Ga0184642_1520820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium596Open in IMG/M
3300019883|Ga0193725_1065605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium904Open in IMG/M
3300020002|Ga0193730_1143379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium638Open in IMG/M
3300020018|Ga0193721_1011176All Organisms → cellular organisms → Bacteria2356Open in IMG/M
3300021078|Ga0210381_10270321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium608Open in IMG/M
3300021080|Ga0210382_10125313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1087Open in IMG/M
3300021080|Ga0210382_10432619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium583Open in IMG/M
3300021363|Ga0193699_10368850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium597Open in IMG/M
3300023058|Ga0193714_1041917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium665Open in IMG/M
3300025918|Ga0207662_10510598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium829Open in IMG/M
3300026285|Ga0209438_1222145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium509Open in IMG/M
3300026300|Ga0209027_1161930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium750Open in IMG/M
3300026300|Ga0209027_1178610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi696Open in IMG/M
3300026301|Ga0209238_1114011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium900Open in IMG/M
3300026310|Ga0209239_1090286All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300026334|Ga0209377_1226541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300026335|Ga0209804_1100027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1335Open in IMG/M
3300026523|Ga0209808_1065285All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300026523|Ga0209808_1166613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium813Open in IMG/M
3300026529|Ga0209806_1317568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
3300026537|Ga0209157_1065999All Organisms → cellular organisms → Bacteria1838Open in IMG/M
3300027846|Ga0209180_10169176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1260Open in IMG/M
3300027875|Ga0209283_10499163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium783Open in IMG/M
3300027882|Ga0209590_10183278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1316Open in IMG/M
3300027882|Ga0209590_10378879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium913Open in IMG/M
3300028536|Ga0137415_10018005All Organisms → cellular organisms → Bacteria7007Open in IMG/M
3300028673|Ga0257175_1082144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300028771|Ga0307320_10265345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium678Open in IMG/M
3300028807|Ga0307305_10052612All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300028811|Ga0307292_10081914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1249Open in IMG/M
3300028819|Ga0307296_10139079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1309Open in IMG/M
3300028878|Ga0307278_10485944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium540Open in IMG/M
3300031720|Ga0307469_11249075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium704Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil11.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil10.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.35%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand7.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.93%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012184Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1357J11328_1019506523300000574GroundwaterAAAVRVVPASLGPDVGLVGAALAACERAAGRGEWFL*
JGI10216J12902_10027706413300000956SoilKGAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR*
JGI10216J12902_10302849613300000956SoilTRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
JGI10216J12902_11573996713300000956SoilDRAFRAPASAVRVVPAALGRDVGMLGAVVAARERLSGRGEWFL*
JGI12053J15887_1005340533300001661Forest SoilRAFRAPASAVRLVPSALGGDVGMLGAVFGARDRLAGRGEWFL*
JGI25384J37096_1022882623300002561Grasslands SoilPAHTLEPMRRAIASRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
JGI25382J43887_1027845323300002908Grasslands SoilRAIASRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0062592_10118948023300004480SoilMRRAIMARAFKVPGAAANVVPAALGRDVGMLGAVFAARERLSGRGEWFL*
Ga0066683_1003024313300005172SoilSLIVIGGSVAEHEPAHTIEPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0065715_1077506613300005293Miscanthus RhizosphereAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL*
Ga0070673_10058724423300005364Switchgrass RhizosphereRAIAERAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL*
Ga0066682_1006528813300005450SoilTLEPMRRAIAARAFRVAAEAVRIVPPGLGRDVGMLGAVLSVRERLAGRAEWFI*
Ga0066682_1086929423300005450SoilFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL*
Ga0066681_1033541123300005451SoilFKVPALAVRVEPAALGADVGMLGAVLEARERAASRGAWFL*
Ga0070706_10003635913300005467Corn, Switchgrass And Miscanthus RhizosphereEHEPSHTIELMRRAIAARAFKVAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDGWFR*
Ga0070707_10054911923300005468Corn, Switchgrass And Miscanthus RhizospherePAHTIEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGGWFL*
Ga0070696_10153393513300005546Corn, Switchgrass And Miscanthus RhizosphereMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRADWFL*
Ga0066695_1066479013300005553SoilVGGSIADNQPGHVLEPMRRAIAERAFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL*
Ga0066670_1017401223300005560SoilIAERAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0066703_1015238413300005568SoilGSIADNQPGHVLEPMRRAIAERAFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL*
Ga0066703_1078507213300005568SoilAHTLEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL*
Ga0066705_1083824123300005569SoilLAVRVEPAALGADVGMLGAVLEARERAATRGAWFL*
Ga0068854_10206714313300005578Corn RhizospherePMRRAITERAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL*
Ga0068861_10063353123300005719Switchgrass RhizosphereKQPAHVLEPMRLAIAERAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL*
Ga0066659_1052144113300006797SoilAEHEPARTLEPMRRGIAERAFKVPRDAVRVVPAALGRDVGMLGAAIAARERSSGRGEWFL
Ga0066659_1140210613300006797SoilRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRSGWFL*
Ga0075430_10142048613300006846Populus RhizosphereRAVRLVPAALGADVGMHGAVLEARERAAGRGDWFL*
Ga0066710_10020352943300009012Grasslands SoilVGGSIADNQPGHVLEPMRRAIAERAFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL
Ga0066710_10377022823300009012Grasslands SoilDAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0099829_1033536713300009038Vadose Zone SoilFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL*
Ga0105095_1027183633300009053Freshwater SedimentRAPADAVQVVPAALGADVGMLGAVFAARERLSGRGEWFL*
Ga0099830_1078338223300009088Vadose Zone SoilPAAAVRLVPAALGADVGMHGAVLEARERASGRGDWFL*
Ga0099827_1060129213300009090Vadose Zone SoilEPGHTLEPMRKAIIARAFKVAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR*
Ga0099827_1121557923300009090Vadose Zone SoilAFRVAANAVQVVPAALGRDVGMLGAVIAARERLAGRGEWFL*
Ga0114129_1067650623300009147Populus RhizosphereAFRAPAAAVRLVPAALGADVGMHGAVLEAQERVAGRGDWFL*
Ga0114129_1286801113300009147Populus RhizosphereLEPMRRAIDTRAFRVAADAVRVVPAALGRDVGMLGAVISLRERLAGRAEWFL*
Ga0134088_1004237713300010304Grasslands SoilGHVLEPMRRAIAERAFRAPAAAVRVVPAALGGEVGMIGAVFAARERLSGRGEWFL*
Ga0134111_1050669213300010329Grasslands SoilKVAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR*
Ga0134063_1012535923300010335Grasslands SoilMRRAIVTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL*
Ga0134063_1018273613300010335Grasslands SoilHTLEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL*
Ga0136623_1013661223300012045Polar Desert SandLEPMRRAIQARAFRVPAASVTVVPAALGADVGLIGSVLAARERGAGRGDWFL*
Ga0136621_103229113300012092Polar Desert SandRAIQARAFRVPAASVTVVPAALGADVGLIGSVLAARERGAGRGEWFL*
Ga0136610_115794713300012184Polar Desert SandVPAASVRVVRADLGADVALLGSVLAARERAAGRGEWFL*
Ga0137364_1052150613300012198Vadose Zone SoilETLGIAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0137364_1098684523300012198Vadose Zone SoilAIAARAFKVAAAAVRIVPAALGRDVGMLGAVIYARERRAGRDEWFR*
Ga0137379_1086443613300012209Vadose Zone SoilIADNQPGHVLEPMRRAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL*
Ga0137379_1087263713300012209Vadose Zone SoilVLTPMRAAIAARAFKAPAAAVRLVPAALGQDVGMHGAVLEARERAAGRGEWFL*
Ga0137378_1042763813300012210Vadose Zone SoilMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0137377_1139684913300012211Vadose Zone SoilRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRAEWFL*
Ga0137387_1038058613300012349Vadose Zone SoilTIEPMRQAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRAEWFL*
Ga0137367_1096476723300012353Vadose Zone SoilAAVRVEPAALGGDVGMVGAVLAARERVSGKGEWFL*
Ga0136635_1007123623300012530Polar Desert SandIVVGGSVAEHQPVHVLEPMRRAIAMRAFRVPAASVTVVPAALGADVALLGSVLAARERAAGRGEWFL*
Ga0137373_1041204113300012532Vadose Zone SoilRAIAERAFRAPAAAVRVVPSALGGDVGMLGAALAARERLSGRGEWFL*
Ga0157216_1001890713300012668Glacier Forefield SoilEHQPAHVLEPMRRAIEARAFRVPAASVRVVPAGLGADVSLLGAVLAARERAAGRGEWFL*
Ga0136614_1010235433300012684Polar Desert SandAASVTVVPAALGADVGLIGSVLAARERGAGRGDWFL*
Ga0136614_1016826233300012684Polar Desert SandPMRRAIGARAFRVPAGSVRVVPAALGPDVALLGSVLAARERSAGLGEWFL*
Ga0137395_1118820323300012917Vadose Zone SoilRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0134077_1020100713300012972Grasslands SoilTIEPMRRAIAERAFRVAANAVQVVPAALGHDVGMLGAVIAARERSSGRGEWFR*
Ga0134077_1025154523300012972Grasslands SoilRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0134077_1045872413300012972Grasslands SoilHTIEPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRGEWFL*
Ga0120123_110128223300013770PermafrostMSRPRIRPAIDARAFRVAADAVRVVPAALGRDVGMLGAVISVRERLAGRGEWFL*
Ga0157377_1112923813300014745Miscanthus RhizosphereAPAAAVRIVPATLGGDVGMLGAVLEARERAAGRGDWFL*
Ga0137418_1050441013300015241Vadose Zone SoilASAVRLVPSALGGDVGMLGAVFGARERLAGRGEWFL*
Ga0134089_1008220013300015358Grasslands SoilIADRAFRAPAAAVRVVPAALGADVGMHGAVLEARERASGRGDWFL*
Ga0134085_1042659713300015359Grasslands SoilIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL*
Ga0134069_131551013300017654Grasslands SoilAERAFRAPAAAVRVVPAALGGEVGMIGAVFAARERLSGRGEWFL
Ga0134112_1039790523300017656Grasslands SoilFKVPRDAVRVVQAALGRDVGMLGAAIAARERSSGRGEWFL
Ga0136617_1021249713300017789Polar Desert SandVAEHQPVHVLEPMRRAIAARAFRVPASSVTVVPAALGADVGLLGSVLAARERAAGRGEWF
Ga0136617_1092558713300017789Polar Desert SandVAEHQPVHVLEPMRRAIAARAFRVPASSVTVVPAALGADVALLGSVLAARERAAGRGEWF
Ga0184619_1013104513300018061Groundwater SedimentRVAADAVRVVPAALGRDVGMLGAVISVRERLAGRAEWFL
Ga0184619_1036667723300018061Groundwater SedimentRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL
Ga0066667_1008791613300018433Grasslands SoilIADRAFKVAAAAVKIVPAALGRDVGMLGAVIYGRERVAGRDEWFR
Ga0066667_1149494213300018433Grasslands SoilVAADAVRIVPPGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0066669_1038187313300018482Grasslands SoilAHTLEPMRRAIAARAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0184642_152082023300019279Groundwater SedimentAIAARAFKVAAAAVRVVPASLGRDVGMLGAVIYAKERLSGRDEWFR
Ga0193725_106560523300019883SoilVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0193730_114337913300020002SoilPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0193721_101117613300020018SoilVVGGSVAEHEPAHTLEPMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRAEWFL
Ga0210381_1027032113300021078Groundwater SedimentEHEPAHTIEPMRRAIATRAFRVAADAVRLVPPRLGRDVGMLGAVISVRERLAGRAEWFL
Ga0210382_1012531313300021080Groundwater SedimentRRAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL
Ga0210382_1043261913300021080Groundwater SedimentHTLEPMRRSIAERAFRVAAEAVRVVPASLGRDVGMLGAVISVRERLAGRAEWFL
Ga0193699_1036885013300021363SoilETMRRAITERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL
Ga0193714_104191713300023058SoilIVVGGSVAQHEPAHTLEPMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRADWFL
Ga0207662_1051059823300025918Switchgrass RhizosphereRAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRADWFL
Ga0209438_122214523300026285Grasslands SoilIEPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0209027_116193013300026300Grasslands SoilAARAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0209027_117861023300026300Grasslands SoilRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0209238_111401123300026301Grasslands SoilMRRSIAERAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0209239_109028613300026310Grasslands SoilRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209377_122654113300026334SoilAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209804_110002733300026335SoilLEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209808_106528533300026523SoilPEHTLEVMRRAIAARAFKVAAAAVRILPAALGRDVGMLGAVIYARERRAGRDEWFR
Ga0209808_116661313300026523SoilDTRAFRVAADAVRLEPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209806_131756823300026529SoilRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209157_106599933300026537SoilAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209180_1016917623300027846Vadose Zone SoilDAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0209283_1049916323300027875Vadose Zone SoilHEPAHTLEPMRRAIDARAFRVAADSVRLVPAALGRDVGMLGAVISVRERLAGRAEWFL
Ga0209590_1018327823300027882Vadose Zone SoilQPVHVLETMRRAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL
Ga0209590_1037887923300027882Vadose Zone SoilAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR
Ga0137415_1001800563300028536Vadose Zone SoilAAVRLVPAALGADVGMYGAVLEARERASGRGDWFL
Ga0257175_108214413300028673SoilIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL
Ga0307320_1026534513300028771SoilPAHTIEPMRRAIAARAFRVAADAVRLAPPGLGRDVGMLGAVISVRERLAGRAEWFL
Ga0307305_1005261233300028807SoilAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL
Ga0307292_1008191413300028811SoilAEHEPAHTLEPMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRAEWFL
Ga0307296_1013907933300028819SoilDAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL
Ga0307278_1048594413300028878SoilTLEPMRNAITARAFKVAAAAVRVVPASLGRDVGMLGAVIYAKERLAGRDEWFR
Ga0307469_1124907523300031720Hardwood Forest SoilMRRAIAARAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRAEWFL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.