| Basic Information | |
|---|---|
| Family ID | F091670 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 48 residues |
| Representative Sequence | AIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.383 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.89% β-sheet: 0.00% Coil/Unstructured: 58.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02800 | Gp_dh_C | 48.60 |
| PF00044 | Gp_dh_N | 41.12 |
| PF00162 | PGK | 5.61 |
| PF01326 | PPDK_N | 0.93 |
| PF13883 | Pyrid_oxidase_2 | 0.93 |
| PF03952 | Enolase_N | 0.93 |
| PF00480 | ROK | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 89.72 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 5.61 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.87 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000574|JGI1357J11328_10195065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300000956|JGI10216J12902_100277064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1016 | Open in IMG/M |
| 3300000956|JGI10216J12902_103028496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 789 | Open in IMG/M |
| 3300000956|JGI10216J12902_115739967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 799 | Open in IMG/M |
| 3300001661|JGI12053J15887_10053405 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300002561|JGI25384J37096_10228826 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300002908|JGI25382J43887_10278453 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300004480|Ga0062592_101189480 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005172|Ga0066683_10030243 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
| 3300005293|Ga0065715_10775066 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005364|Ga0070673_100587244 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300005450|Ga0066682_10065288 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300005450|Ga0066682_10869294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300005451|Ga0066681_10335411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 928 | Open in IMG/M |
| 3300005467|Ga0070706_100036359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4548 | Open in IMG/M |
| 3300005468|Ga0070707_100549119 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005546|Ga0070696_101533935 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005553|Ga0066695_10664790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 615 | Open in IMG/M |
| 3300005560|Ga0066670_10174012 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300005568|Ga0066703_10152384 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300005568|Ga0066703_10785072 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005569|Ga0066705_10838241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300005578|Ga0068854_102067143 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005719|Ga0068861_100633531 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300006797|Ga0066659_10521441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 956 | Open in IMG/M |
| 3300006797|Ga0066659_11402106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300006846|Ga0075430_101420486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300009012|Ga0066710_100203529 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300009012|Ga0066710_103770228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300009038|Ga0099829_10335367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1243 | Open in IMG/M |
| 3300009053|Ga0105095_10271836 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300009088|Ga0099830_10783382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 786 | Open in IMG/M |
| 3300009090|Ga0099827_10601292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 948 | Open in IMG/M |
| 3300009090|Ga0099827_11215579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
| 3300009147|Ga0114129_10676506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1329 | Open in IMG/M |
| 3300009147|Ga0114129_12868011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
| 3300010304|Ga0134088_10042377 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300010329|Ga0134111_10506692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 530 | Open in IMG/M |
| 3300010335|Ga0134063_10125359 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300010335|Ga0134063_10182736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 982 | Open in IMG/M |
| 3300012045|Ga0136623_10136612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1065 | Open in IMG/M |
| 3300012092|Ga0136621_1032291 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300012184|Ga0136610_1157947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 786 | Open in IMG/M |
| 3300012198|Ga0137364_10521506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 894 | Open in IMG/M |
| 3300012198|Ga0137364_10986845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
| 3300012209|Ga0137379_10864436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 809 | Open in IMG/M |
| 3300012209|Ga0137379_10872637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 804 | Open in IMG/M |
| 3300012210|Ga0137378_10427638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1227 | Open in IMG/M |
| 3300012211|Ga0137377_11396849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 629 | Open in IMG/M |
| 3300012349|Ga0137387_10380586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1023 | Open in IMG/M |
| 3300012353|Ga0137367_10964767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300012530|Ga0136635_10071236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1073 | Open in IMG/M |
| 3300012532|Ga0137373_10412041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1047 | Open in IMG/M |
| 3300012668|Ga0157216_10018907 | All Organisms → cellular organisms → Bacteria | 3618 | Open in IMG/M |
| 3300012684|Ga0136614_10102354 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300012684|Ga0136614_10168262 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300012917|Ga0137395_11188203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300012972|Ga0134077_10201007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 812 | Open in IMG/M |
| 3300012972|Ga0134077_10251545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 732 | Open in IMG/M |
| 3300012972|Ga0134077_10458724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
| 3300013770|Ga0120123_1101282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 657 | Open in IMG/M |
| 3300014745|Ga0157377_11129238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 602 | Open in IMG/M |
| 3300015241|Ga0137418_10504410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 967 | Open in IMG/M |
| 3300015358|Ga0134089_10082200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1215 | Open in IMG/M |
| 3300015359|Ga0134085_10426597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
| 3300017654|Ga0134069_1315510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
| 3300017656|Ga0134112_10397905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300017789|Ga0136617_10212497 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300017789|Ga0136617_10925587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
| 3300018061|Ga0184619_10131045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1138 | Open in IMG/M |
| 3300018061|Ga0184619_10366677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 656 | Open in IMG/M |
| 3300018433|Ga0066667_10087916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2026 | Open in IMG/M |
| 3300018433|Ga0066667_11494942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300018482|Ga0066669_10381873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1185 | Open in IMG/M |
| 3300019279|Ga0184642_1520820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300019883|Ga0193725_1065605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 904 | Open in IMG/M |
| 3300020002|Ga0193730_1143379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
| 3300020018|Ga0193721_1011176 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300021078|Ga0210381_10270321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 608 | Open in IMG/M |
| 3300021080|Ga0210382_10125313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1087 | Open in IMG/M |
| 3300021080|Ga0210382_10432619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300021363|Ga0193699_10368850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300023058|Ga0193714_1041917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
| 3300025918|Ga0207662_10510598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 829 | Open in IMG/M |
| 3300026285|Ga0209438_1222145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300026300|Ga0209027_1161930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 750 | Open in IMG/M |
| 3300026300|Ga0209027_1178610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 696 | Open in IMG/M |
| 3300026301|Ga0209238_1114011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 900 | Open in IMG/M |
| 3300026310|Ga0209239_1090286 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300026334|Ga0209377_1226541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300026335|Ga0209804_1100027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1335 | Open in IMG/M |
| 3300026523|Ga0209808_1065285 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300026523|Ga0209808_1166613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300026529|Ga0209806_1317568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300026537|Ga0209157_1065999 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300027846|Ga0209180_10169176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1260 | Open in IMG/M |
| 3300027875|Ga0209283_10499163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 783 | Open in IMG/M |
| 3300027882|Ga0209590_10183278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1316 | Open in IMG/M |
| 3300027882|Ga0209590_10378879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 913 | Open in IMG/M |
| 3300028536|Ga0137415_10018005 | All Organisms → cellular organisms → Bacteria | 7007 | Open in IMG/M |
| 3300028673|Ga0257175_1082144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 619 | Open in IMG/M |
| 3300028771|Ga0307320_10265345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 678 | Open in IMG/M |
| 3300028807|Ga0307305_10052612 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300028811|Ga0307292_10081914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1249 | Open in IMG/M |
| 3300028819|Ga0307296_10139079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1309 | Open in IMG/M |
| 3300028878|Ga0307278_10485944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300031720|Ga0307469_11249075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 704 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.35% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 7.48% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1357J11328_101950652 | 3300000574 | Groundwater | AAAVRVVPASLGPDVGLVGAALAACERAAGRGEWFL* |
| JGI10216J12902_1002770641 | 3300000956 | Soil | KGAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR* |
| JGI10216J12902_1030284961 | 3300000956 | Soil | TRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| JGI10216J12902_1157399671 | 3300000956 | Soil | DRAFRAPASAVRVVPAALGRDVGMLGAVVAARERLSGRGEWFL* |
| JGI12053J15887_100534053 | 3300001661 | Forest Soil | RAFRAPASAVRLVPSALGGDVGMLGAVFGARDRLAGRGEWFL* |
| JGI25384J37096_102288262 | 3300002561 | Grasslands Soil | PAHTLEPMRRAIASRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| JGI25382J43887_102784532 | 3300002908 | Grasslands Soil | RAIASRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0062592_1011894802 | 3300004480 | Soil | MRRAIMARAFKVPGAAANVVPAALGRDVGMLGAVFAARERLSGRGEWFL* |
| Ga0066683_100302431 | 3300005172 | Soil | SLIVIGGSVAEHEPAHTIEPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0065715_107750661 | 3300005293 | Miscanthus Rhizosphere | AFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0070673_1005872442 | 3300005364 | Switchgrass Rhizosphere | RAIAERAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0066682_100652881 | 3300005450 | Soil | TLEPMRRAIAARAFRVAAEAVRIVPPGLGRDVGMLGAVLSVRERLAGRAEWFI* |
| Ga0066682_108692942 | 3300005450 | Soil | FRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0066681_103354112 | 3300005451 | Soil | FKVPALAVRVEPAALGADVGMLGAVLEARERAASRGAWFL* |
| Ga0070706_1000363591 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EHEPSHTIELMRRAIAARAFKVAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDGWFR* |
| Ga0070707_1005491192 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PAHTIEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGGWFL* |
| Ga0070696_1015339351 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRADWFL* |
| Ga0066695_106647901 | 3300005553 | Soil | VGGSIADNQPGHVLEPMRRAIAERAFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0066670_101740122 | 3300005560 | Soil | IAERAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0066703_101523841 | 3300005568 | Soil | GSIADNQPGHVLEPMRRAIAERAFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0066703_107850721 | 3300005568 | Soil | AHTLEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL* |
| Ga0066705_108382412 | 3300005569 | Soil | LAVRVEPAALGADVGMLGAVLEARERAATRGAWFL* |
| Ga0068854_1020671431 | 3300005578 | Corn Rhizosphere | PMRRAITERAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0068861_1006335312 | 3300005719 | Switchgrass Rhizosphere | KQPAHVLEPMRLAIAERAFRAPAGAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0066659_105214411 | 3300006797 | Soil | AEHEPARTLEPMRRGIAERAFKVPRDAVRVVPAALGRDVGMLGAAIAARERSSGRGEWFL |
| Ga0066659_114021061 | 3300006797 | Soil | RVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRSGWFL* |
| Ga0075430_1014204861 | 3300006846 | Populus Rhizosphere | RAVRLVPAALGADVGMHGAVLEARERAAGRGDWFL* |
| Ga0066710_1002035294 | 3300009012 | Grasslands Soil | VGGSIADNQPGHVLEPMRRAIAERAFRAPASAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0066710_1037702282 | 3300009012 | Grasslands Soil | DAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0099829_103353671 | 3300009038 | Vadose Zone Soil | FRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL* |
| Ga0105095_102718363 | 3300009053 | Freshwater Sediment | RAPADAVQVVPAALGADVGMLGAVFAARERLSGRGEWFL* |
| Ga0099830_107833822 | 3300009088 | Vadose Zone Soil | PAAAVRLVPAALGADVGMHGAVLEARERASGRGDWFL* |
| Ga0099827_106012921 | 3300009090 | Vadose Zone Soil | EPGHTLEPMRKAIIARAFKVAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR* |
| Ga0099827_112155792 | 3300009090 | Vadose Zone Soil | AFRVAANAVQVVPAALGRDVGMLGAVIAARERLAGRGEWFL* |
| Ga0114129_106765062 | 3300009147 | Populus Rhizosphere | AFRAPAAAVRLVPAALGADVGMHGAVLEAQERVAGRGDWFL* |
| Ga0114129_128680111 | 3300009147 | Populus Rhizosphere | LEPMRRAIDTRAFRVAADAVRVVPAALGRDVGMLGAVISLRERLAGRAEWFL* |
| Ga0134088_100423771 | 3300010304 | Grasslands Soil | GHVLEPMRRAIAERAFRAPAAAVRVVPAALGGEVGMIGAVFAARERLSGRGEWFL* |
| Ga0134111_105066921 | 3300010329 | Grasslands Soil | KVAAAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR* |
| Ga0134063_101253592 | 3300010335 | Grasslands Soil | MRRAIVTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL* |
| Ga0134063_101827361 | 3300010335 | Grasslands Soil | HTLEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL* |
| Ga0136623_101366122 | 3300012045 | Polar Desert Sand | LEPMRRAIQARAFRVPAASVTVVPAALGADVGLIGSVLAARERGAGRGDWFL* |
| Ga0136621_10322911 | 3300012092 | Polar Desert Sand | RAIQARAFRVPAASVTVVPAALGADVGLIGSVLAARERGAGRGEWFL* |
| Ga0136610_11579471 | 3300012184 | Polar Desert Sand | VPAASVRVVRADLGADVALLGSVLAARERAAGRGEWFL* |
| Ga0137364_105215061 | 3300012198 | Vadose Zone Soil | ETLGIAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0137364_109868452 | 3300012198 | Vadose Zone Soil | AIAARAFKVAAAAVRIVPAALGRDVGMLGAVIYARERRAGRDEWFR* |
| Ga0137379_108644361 | 3300012209 | Vadose Zone Soil | IADNQPGHVLEPMRRAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL* |
| Ga0137379_108726371 | 3300012209 | Vadose Zone Soil | VLTPMRAAIAARAFKAPAAAVRLVPAALGQDVGMHGAVLEARERAAGRGEWFL* |
| Ga0137378_104276381 | 3300012210 | Vadose Zone Soil | MRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0137377_113968491 | 3300012211 | Vadose Zone Soil | RVAADAVRLVPPGLGRDVGMLGAVISARERLAGRAEWFL* |
| Ga0137387_103805861 | 3300012349 | Vadose Zone Soil | TIEPMRQAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRAEWFL* |
| Ga0137367_109647672 | 3300012353 | Vadose Zone Soil | AAVRVEPAALGGDVGMVGAVLAARERVSGKGEWFL* |
| Ga0136635_100712362 | 3300012530 | Polar Desert Sand | IVVGGSVAEHQPVHVLEPMRRAIAMRAFRVPAASVTVVPAALGADVALLGSVLAARERAAGRGEWFL* |
| Ga0137373_104120411 | 3300012532 | Vadose Zone Soil | RAIAERAFRAPAAAVRVVPSALGGDVGMLGAALAARERLSGRGEWFL* |
| Ga0157216_100189071 | 3300012668 | Glacier Forefield Soil | EHQPAHVLEPMRRAIEARAFRVPAASVRVVPAGLGADVSLLGAVLAARERAAGRGEWFL* |
| Ga0136614_101023543 | 3300012684 | Polar Desert Sand | AASVTVVPAALGADVGLIGSVLAARERGAGRGDWFL* |
| Ga0136614_101682623 | 3300012684 | Polar Desert Sand | PMRRAIGARAFRVPAGSVRVVPAALGPDVALLGSVLAARERSAGLGEWFL* |
| Ga0137395_111882032 | 3300012917 | Vadose Zone Soil | RVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0134077_102010071 | 3300012972 | Grasslands Soil | TIEPMRRAIAERAFRVAANAVQVVPAALGHDVGMLGAVIAARERSSGRGEWFR* |
| Ga0134077_102515452 | 3300012972 | Grasslands Soil | RRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0134077_104587241 | 3300012972 | Grasslands Soil | HTIEPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRGEWFL* |
| Ga0120123_11012822 | 3300013770 | Permafrost | MSRPRIRPAIDARAFRVAADAVRVVPAALGRDVGMLGAVISVRERLAGRGEWFL* |
| Ga0157377_111292381 | 3300014745 | Miscanthus Rhizosphere | APAAAVRIVPATLGGDVGMLGAVLEARERAAGRGDWFL* |
| Ga0137418_105044101 | 3300015241 | Vadose Zone Soil | ASAVRLVPSALGGDVGMLGAVFGARERLAGRGEWFL* |
| Ga0134089_100822001 | 3300015358 | Grasslands Soil | IADRAFRAPAAAVRVVPAALGADVGMHGAVLEARERASGRGDWFL* |
| Ga0134085_104265971 | 3300015359 | Grasslands Soil | IATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL* |
| Ga0134069_13155101 | 3300017654 | Grasslands Soil | AERAFRAPAAAVRVVPAALGGEVGMIGAVFAARERLSGRGEWFL |
| Ga0134112_103979052 | 3300017656 | Grasslands Soil | FKVPRDAVRVVQAALGRDVGMLGAAIAARERSSGRGEWFL |
| Ga0136617_102124971 | 3300017789 | Polar Desert Sand | VAEHQPVHVLEPMRRAIAARAFRVPASSVTVVPAALGADVGLLGSVLAARERAAGRGEWF |
| Ga0136617_109255871 | 3300017789 | Polar Desert Sand | VAEHQPVHVLEPMRRAIAARAFRVPASSVTVVPAALGADVALLGSVLAARERAAGRGEWF |
| Ga0184619_101310451 | 3300018061 | Groundwater Sediment | RVAADAVRVVPAALGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0184619_103666772 | 3300018061 | Groundwater Sediment | RAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0066667_100879161 | 3300018433 | Grasslands Soil | IADRAFKVAAAAVKIVPAALGRDVGMLGAVIYGRERVAGRDEWFR |
| Ga0066667_114949421 | 3300018433 | Grasslands Soil | VAADAVRIVPPGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0066669_103818731 | 3300018482 | Grasslands Soil | AHTLEPMRRAIAARAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0184642_15208202 | 3300019279 | Groundwater Sediment | AIAARAFKVAAAAVRVVPASLGRDVGMLGAVIYAKERLSGRDEWFR |
| Ga0193725_10656052 | 3300019883 | Soil | VAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0193730_11433791 | 3300020002 | Soil | PMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0193721_10111761 | 3300020018 | Soil | VVGGSVAEHEPAHTLEPMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0210381_102703211 | 3300021078 | Groundwater Sediment | EHEPAHTIEPMRRAIATRAFRVAADAVRLVPPRLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0210382_101253131 | 3300021080 | Groundwater Sediment | RRAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0210382_104326191 | 3300021080 | Groundwater Sediment | HTLEPMRRSIAERAFRVAAEAVRVVPASLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0193699_103688501 | 3300021363 | Soil | ETMRRAITERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0193714_10419171 | 3300023058 | Soil | IVVGGSVAQHEPAHTLEPMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRADWFL |
| Ga0207662_105105982 | 3300025918 | Switchgrass Rhizosphere | RAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRADWFL |
| Ga0209438_12221452 | 3300026285 | Grasslands Soil | IEPMRRAIATRAFRVAADAVRLVPPGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0209027_11619301 | 3300026300 | Grasslands Soil | AARAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0209027_11786102 | 3300026300 | Grasslands Soil | RVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0209238_11140112 | 3300026301 | Grasslands Soil | MRRSIAERAFRVAAEAVRVVPAGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0209239_10902861 | 3300026310 | Grasslands Soil | RVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209377_12265411 | 3300026334 | Soil | AIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209804_11000273 | 3300026335 | Soil | LEPMRRAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209808_10652853 | 3300026523 | Soil | PEHTLEVMRRAIAARAFKVAAAAVRILPAALGRDVGMLGAVIYARERRAGRDEWFR |
| Ga0209808_11666131 | 3300026523 | Soil | DTRAFRVAADAVRLEPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209806_13175682 | 3300026529 | Soil | RAIDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209157_10659993 | 3300026537 | Soil | AFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209180_101691762 | 3300027846 | Vadose Zone Soil | DAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0209283_104991632 | 3300027875 | Vadose Zone Soil | HEPAHTLEPMRRAIDARAFRVAADSVRLVPAALGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0209590_101832782 | 3300027882 | Vadose Zone Soil | QPVHVLETMRRAIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0209590_103788792 | 3300027882 | Vadose Zone Soil | AAAVRVVPAALGRDVGMLGAVIYARERLAGRDEWFR |
| Ga0137415_100180056 | 3300028536 | Vadose Zone Soil | AAVRLVPAALGADVGMYGAVLEARERASGRGDWFL |
| Ga0257175_10821441 | 3300028673 | Soil | IDTRAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRGEWFL |
| Ga0307320_102653451 | 3300028771 | Soil | PAHTIEPMRRAIAARAFRVAADAVRLAPPGLGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0307305_100526123 | 3300028807 | Soil | AIAERAFRAPAAAVRVVPAALGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0307292_100819141 | 3300028811 | Soil | AEHEPAHTLEPMRRAIAARAFKVAADAVRVVPAALGRDVGMLGAVISVRERLAGRAEWFL |
| Ga0307296_101390793 | 3300028819 | Soil | DAVRVVPAELGGDVGMLGAVFAARERLSGRGEWFL |
| Ga0307278_104859441 | 3300028878 | Soil | TLEPMRNAITARAFKVAAAAVRVVPASLGRDVGMLGAVIYAKERLAGRDEWFR |
| Ga0307469_112490752 | 3300031720 | Hardwood Forest Soil | MRRAIAARAFRVAADAVRLVPPGLGRDVGMLGAVISARERLAGRAEWFL |
| ⦗Top⦘ |