| Basic Information | |
|---|---|
| Family ID | F091660 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PHGMPAYGGLLPPDAIWKLVTYLQSLEPPANVPTQSWR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 88.79 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.206 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07885 | Ion_trans_2 | 19.63 |
| PF12710 | HAD | 4.67 |
| PF07722 | Peptidase_C26 | 3.74 |
| PF14464 | Prok-JAB | 2.80 |
| PF01957 | NfeD | 2.80 |
| PF12704 | MacB_PCD | 1.87 |
| PF07883 | Cupin_2 | 1.87 |
| PF02687 | FtsX | 1.87 |
| PF04389 | Peptidase_M28 | 1.87 |
| PF07992 | Pyr_redox_2 | 1.87 |
| PF00106 | adh_short | 1.87 |
| PF12833 | HTH_18 | 0.93 |
| PF02126 | PTE | 0.93 |
| PF05157 | T2SSE_N | 0.93 |
| PF00593 | TonB_dep_Rec | 0.93 |
| PF00754 | F5_F8_type_C | 0.93 |
| PF05694 | SBP56 | 0.93 |
| PF13419 | HAD_2 | 0.93 |
| PF13360 | PQQ_2 | 0.93 |
| PF00486 | Trans_reg_C | 0.93 |
| PF01243 | Putative_PNPOx | 0.93 |
| PF10688 | Imp-YgjV | 0.93 |
| PF01145 | Band_7 | 0.93 |
| PF00072 | Response_reg | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.13 % |
| Unclassified | root | N/A | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10156524 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300002562|JGI25382J37095_10162975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300002909|JGI25388J43891_1023496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300002916|JGI25389J43894_1085158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005166|Ga0066674_10163938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300005172|Ga0066683_10566564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 692 | Open in IMG/M |
| 3300005175|Ga0066673_10054534 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
| 3300005181|Ga0066678_10822414 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005187|Ga0066675_10644448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300005187|Ga0066675_11056126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 608 | Open in IMG/M |
| 3300005187|Ga0066675_11412134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300005366|Ga0070659_101408142 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005451|Ga0066681_10020003 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300005458|Ga0070681_10415770 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300005530|Ga0070679_101228670 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005536|Ga0070697_100095993 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300005559|Ga0066700_10732304 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005575|Ga0066702_10031183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2729 | Open in IMG/M |
| 3300005575|Ga0066702_10083696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1790 | Open in IMG/M |
| 3300005586|Ga0066691_10156249 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005586|Ga0066691_10879587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 527 | Open in IMG/M |
| 3300006797|Ga0066659_11465131 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006800|Ga0066660_10317401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1251 | Open in IMG/M |
| 3300006806|Ga0079220_10524716 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300006854|Ga0075425_100586988 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300006903|Ga0075426_10206584 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300006903|Ga0075426_10372412 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300006914|Ga0075436_100903720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 660 | Open in IMG/M |
| 3300006914|Ga0075436_101190699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300007258|Ga0099793_10090108 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300009012|Ga0066710_101156901 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1198 | Open in IMG/M |
| 3300009088|Ga0099830_11428805 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009093|Ga0105240_11484936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300009093|Ga0105240_12743527 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009137|Ga0066709_100662507 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300009137|Ga0066709_101004210 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300009137|Ga0066709_103378351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
| 3300009551|Ga0105238_10464483 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300010320|Ga0134109_10345361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
| 3300010325|Ga0134064_10093054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 983 | Open in IMG/M |
| 3300010335|Ga0134063_10762683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300010371|Ga0134125_10439003 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300010396|Ga0134126_10030173 | All Organisms → cellular organisms → Bacteria | 6868 | Open in IMG/M |
| 3300010396|Ga0134126_11355238 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012038|Ga0137431_1091409 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012204|Ga0137374_10464963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 990 | Open in IMG/M |
| 3300012204|Ga0137374_10524215 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012209|Ga0137379_11696076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
| 3300012211|Ga0137377_11489080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012349|Ga0137387_10110658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1926 | Open in IMG/M |
| 3300012351|Ga0137386_11237522 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300012360|Ga0137375_10405894 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012362|Ga0137361_10718241 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300012389|Ga0134040_1164547 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300012396|Ga0134057_1097483 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012399|Ga0134061_1379958 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012676|Ga0137341_1047616 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012927|Ga0137416_11565907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
| 3300012972|Ga0134077_10338726 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012975|Ga0134110_10460710 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012976|Ga0134076_10193132 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300014154|Ga0134075_10137007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1044 | Open in IMG/M |
| 3300014166|Ga0134079_10270894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 742 | Open in IMG/M |
| 3300015356|Ga0134073_10009815 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300018078|Ga0184612_10494142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
| 3300018431|Ga0066655_10272230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300018433|Ga0066667_10124372 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300018433|Ga0066667_10331472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300018468|Ga0066662_10338173 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300019279|Ga0184642_1102578 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300020070|Ga0206356_10460413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1083 | Open in IMG/M |
| 3300020199|Ga0179592_10245957 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300021046|Ga0215015_10278031 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025911|Ga0207654_10286432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1116 | Open in IMG/M |
| 3300025912|Ga0207707_10580870 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300025913|Ga0207695_11626406 | Not Available | 527 | Open in IMG/M |
| 3300025914|Ga0207671_10688976 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300026142|Ga0207698_12194711 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026297|Ga0209237_1140724 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300026297|Ga0209237_1184245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 709 | Open in IMG/M |
| 3300026298|Ga0209236_1060036 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300026310|Ga0209239_1006906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6272 | Open in IMG/M |
| 3300026310|Ga0209239_1059347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1701 | Open in IMG/M |
| 3300026310|Ga0209239_1227963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 649 | Open in IMG/M |
| 3300026323|Ga0209472_1191349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300026325|Ga0209152_10094408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1119 | Open in IMG/M |
| 3300026325|Ga0209152_10382157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300026326|Ga0209801_1139085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1031 | Open in IMG/M |
| 3300026326|Ga0209801_1188909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 838 | Open in IMG/M |
| 3300026331|Ga0209267_1257032 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300026334|Ga0209377_1000913 | All Organisms → cellular organisms → Bacteria | 19963 | Open in IMG/M |
| 3300026342|Ga0209057_1066887 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300026527|Ga0209059_1263476 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300026530|Ga0209807_1046656 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300026547|Ga0209156_10401989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300026548|Ga0209161_10043351 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
| 3300026550|Ga0209474_10657194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300026552|Ga0209577_10654804 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027765|Ga0209073_10176821 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300027846|Ga0209180_10047596 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300027846|Ga0209180_10062455 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300028536|Ga0137415_10971303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 660 | Open in IMG/M |
| 3300028784|Ga0307282_10480539 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031421|Ga0308194_10121091 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031820|Ga0307473_10626527 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300032174|Ga0307470_10574040 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300033811|Ga0364924_099600 | Not Available | 659 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101565242 | 3300002558 | Grasslands Soil | QPHGMPAYGGLLPPDAIWKLVTYLQSLEPPADVPTQTWR* |
| JGI25382J37095_101629751 | 3300002562 | Grasslands Soil | FQSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK* |
| JGI25388J43891_10234961 | 3300002909 | Grasslands Soil | IFQSIYYGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPANVPTESWR* |
| JGI25389J43894_10851581 | 3300002916 | Grasslands Soil | YYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWK* |
| Ga0066674_101639382 | 3300005166 | Soil | SIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK* |
| Ga0066683_105665641 | 3300005172 | Soil | PRGMPAFGGILPPDAIWKLVTYLQSLQPAEDHATVSWSK* |
| Ga0066673_100545342 | 3300005175 | Soil | MSNFVHPHGMPAYGGLLLAPEAVWKLVTDIQSLEPSADLPTEVWT* |
| Ga0066678_108224141 | 3300005181 | Soil | YGQPHGMPAYGGLLPPGAIWKVVTYLQSLEPPASVPTQSWK* |
| Ga0066675_106444481 | 3300005187 | Soil | EIFRSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK* |
| Ga0066675_110561262 | 3300005187 | Soil | IFYGRPRGMPAFGGILPPDAIWKVVTYLQYLQPAEDHATVSWSQ* |
| Ga0066675_114121342 | 3300005187 | Soil | SIHYGRPRGMPAFGGVLPPEAIWKLVTYLQSLAPAADLSTVAW* |
| Ga0070659_1014081421 | 3300005366 | Corn Rhizosphere | RRQGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK* |
| Ga0066681_100200034 | 3300005451 | Soil | FQSIYYGRPHGMPAYGGLLLAPEAVWKLVTYIQSLEPPADLPTEAWK* |
| Ga0070681_104157703 | 3300005458 | Corn Rhizosphere | RRQGMPAFGGLMPAAGIWKVVTYLQSLEPPNDVPTESWK* |
| Ga0070679_1012286702 | 3300005530 | Corn Rhizosphere | GRRQGMPAFGGIMPAAGIWKLVTYLQSLEPPNDVPTESWK* |
| Ga0070697_1000959931 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SDGEIFQSIYYGQAHGMPAYGGLLPPGAIWKLVTYLQSLAPPANVPTQSWK* |
| Ga0066700_107323041 | 3300005559 | Soil | PHGMPAYGGLLLSSDAVWKLVTYLQSLAPPADLPTEAWDTSAR* |
| Ga0066702_100311831 | 3300005575 | Soil | MSNFGHPHGTPAYGGLLLAPDAVWKLVTDIQSLEPPADLPTEVWK* |
| Ga0066702_100836963 | 3300005575 | Soil | SIYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLEPAADLSTTSW* |
| Ga0066691_101562491 | 3300005586 | Soil | EIFQSIFYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK* |
| Ga0066691_108795871 | 3300005586 | Soil | GGGDGALFQSIYYGRPRGMPAFGGVLAPDAVWKLVTYLQSLEPPVDVPTERWR* |
| Ga0066659_114651312 | 3300006797 | Soil | AYGGLLLAPEAVWKLVTYIQSLEPPADLPTEAWR* |
| Ga0066660_103174013 | 3300006800 | Soil | MSNFVHPHGMPAYGELLLAPEAVWKLVTDIQSLEPSAGLPTEVWT* |
| Ga0079220_105247161 | 3300006806 | Agricultural Soil | YGRPHGMPAYGGLLLSSDAVWKLVTYLQSLAPPADVPTEAWDTSGR* |
| Ga0075425_1005869881 | 3300006854 | Populus Rhizosphere | IFQSIYYGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPADVPTESWR* |
| Ga0075426_102065842 | 3300006903 | Populus Rhizosphere | YYGRRYGMPAFGGLMPKSGIWRIVTYLQSLPLPNDVPTESWK* |
| Ga0075426_103724122 | 3300006903 | Populus Rhizosphere | GQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPANVPTESWR* |
| Ga0075436_1009037202 | 3300006914 | Populus Rhizosphere | RPRGMPAFGGVLPPEAIWRLVTYLQSLTPAADPATVSW* |
| Ga0075436_1011906992 | 3300006914 | Populus Rhizosphere | MPAYGGVLPPAAIWKLVTYLQSLEPPANVPTQSWR* |
| Ga0099793_100901081 | 3300007258 | Vadose Zone Soil | YYGQAHGMPAYGGLLPAGTIWKVVTYLQLLEPPATVPTQSWK* |
| Ga0066710_1011569011 | 3300009012 | Grasslands Soil | QSIYYGRPRGMPAFGGVLAPDAVWKLVTYLQSLEPPVDVPTERWR |
| Ga0099830_114288051 | 3300009088 | Vadose Zone Soil | HGMPAYGGLLLSPGAVWKLVTYLQALEPPEDVPTERWK* |
| Ga0105240_114849362 | 3300009093 | Corn Rhizosphere | GMPAFGGLMPKAGIWRIVTYLQSLTLPNDVPTESWK* |
| Ga0105240_127435271 | 3300009093 | Corn Rhizosphere | MPAFGGIMPAAGIWNVVTYLQSLEPPNDMPTEPWK* |
| Ga0066709_1006625071 | 3300009137 | Grasslands Soil | ADGEVFHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDVSTVTW* |
| Ga0066709_1010042101 | 3300009137 | Grasslands Soil | RPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDISTVSW* |
| Ga0066709_1033783512 | 3300009137 | Grasslands Soil | FHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDNSTVSW* |
| Ga0105238_104644831 | 3300009551 | Corn Rhizosphere | GMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK* |
| Ga0134109_103453612 | 3300010320 | Grasslands Soil | YGRPRGMPAFGGVLPPDAIWKLVTYLQGLTPAVDPATVAW* |
| Ga0134064_100930543 | 3300010325 | Grasslands Soil | MSNFVHPHGMPAYGGLLLAPEAVWKLVTDIQSLEPPADLPTEVWK* |
| Ga0134063_107626831 | 3300010335 | Grasslands Soil | IFYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK* |
| Ga0134125_104390032 | 3300010371 | Terrestrial Soil | MPAFGGIMPAAGIWKVVTYLQSLAPPNDVPTESWK* |
| Ga0134126_100301731 | 3300010396 | Terrestrial Soil | RRYGMPAFGGLMPKAGIWRIVTYLQSLTLPNDVPTESWK* |
| Ga0134126_113552381 | 3300010396 | Terrestrial Soil | SIYYGRRQGMPAFGGIMPAAGIWKVVTYLQSLAPPNDVPTESWK* |
| Ga0137431_10914091 | 3300012038 | Soil | RPQGMPAFGGLLEPDVIWTLVTYIQSLPVPANVPTQSWVTP* |
| Ga0137374_104649632 | 3300012204 | Vadose Zone Soil | GMPAFGGILPPDAIWKLVTYLRTLQPATDEATVSWIR* |
| Ga0137374_105242152 | 3300012204 | Vadose Zone Soil | SIYLGRPRGMPAFGGILPPEAIWKLVTYLESLEPKHDNPTVAW* |
| Ga0137379_116960762 | 3300012209 | Vadose Zone Soil | MPAFGGILSPDAIWKLVTYVQSLEPPADVPTERWP* |
| Ga0137377_114890801 | 3300012211 | Vadose Zone Soil | SIYYGQPHGMPAYGGLLPPTAIWKLVTYLQSLEPPADVPTESWR* |
| Ga0137387_101106585 | 3300012349 | Vadose Zone Soil | PRGMPAFGGILPPEAIWKLVTYLQSLQPAGDMSTTSWVRRP* |
| Ga0137386_112375221 | 3300012351 | Vadose Zone Soil | VIFQSIFSGRPRGMPAFGGILPPDAIWKLVTYLQSLQPTGDMSTTSWVRRR* |
| Ga0137375_104058941 | 3300012360 | Vadose Zone Soil | PHGMPAYGGLLPPGAIWKVVTYLQGLEPPANVPTQSWK* |
| Ga0137361_107182411 | 3300012362 | Vadose Zone Soil | MPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQAWK* |
| Ga0134040_11645472 | 3300012389 | Grasslands Soil | GMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWH* |
| Ga0134057_10974832 | 3300012396 | Grasslands Soil | RPRGMPAFGGILPPDAIWRLVTYLQSLEPKQDNSTVSW* |
| Ga0134061_13799581 | 3300012399 | Grasslands Soil | RGMPAFGGVLPPEAIWKLVTYLQRLAPAADLSTESW* |
| Ga0137341_10476161 | 3300012676 | Soil | GRPQGMPAFGGLLEPDVIWTLVTYIQSLPVPANVPTQSWVTP* |
| Ga0137416_115659071 | 3300012927 | Vadose Zone Soil | YGRPHGMPAYGGLLQTADAVWPLVTYLQSLTPPADVPTESWLPPPP* |
| Ga0134077_103387263 | 3300012972 | Grasslands Soil | HSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDVSTVTW* |
| Ga0134110_104607102 | 3300012975 | Grasslands Soil | MSNFVHPHGMPAYGGLLLAPKAVWKLVTDIQSLEPSADLPTEVWT* |
| Ga0134076_101931322 | 3300012976 | Grasslands Soil | MPAYGGLLPPGAIWKLVTYLQSLEPPANVPTQSWR* |
| Ga0134075_101370071 | 3300014154 | Grasslands Soil | MPAYGGVLPPEAIWKVVTYLQSLAPREDVPTVSW* |
| Ga0134079_102708942 | 3300014166 | Grasslands Soil | SIYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLAPAVDPATVAW* |
| Ga0134073_100098153 | 3300015356 | Grasslands Soil | YYGQPHGMPAYGGMLPPTAIWKLVTYLQSLEPPANVPTESWR* |
| Ga0184612_104941422 | 3300018078 | Groundwater Sediment | PAFGGALPSDAIWMLVTYLQSLPVPAAVPTQSWEKP |
| Ga0066655_102722301 | 3300018431 | Grasslands Soil | DGAIFQSIYYGRPHGMPTYGGLLLAPEAVWKVVSYIQSLEPPADLPTEAWK |
| Ga0066667_101243724 | 3300018433 | Grasslands Soil | HGMPAFGGILSPDAIWKLVTYVQSLEPPADVPTERWP |
| Ga0066667_103314723 | 3300018433 | Grasslands Soil | YYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWK |
| Ga0066662_103381731 | 3300018468 | Grasslands Soil | VFHSIYYGRPRGMPAFGGILPPDAIWKLVTYLQSLEPKQDVSTVAW |
| Ga0184642_11025781 | 3300019279 | Groundwater Sediment | SIYYGRPHGMPAYGGLLLSPDAVWKLVTYLQALEPPADVPTEAWP |
| Ga0206356_104604132 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGEIFSSIYAGRRQGMPAFGGIMPAAGIWKLVTYLQSLEPPNDVPTESWK |
| Ga0179592_102459571 | 3300020199 | Vadose Zone Soil | PHGMPAYGGLLPPDAIWKLVTYLQSLEPPANVPTQSWR |
| Ga0215015_102780311 | 3300021046 | Soil | PHGMPAYGGLLLSPGAVWRLVTYLQALEPPEDVPTERWK |
| Ga0207654_102864321 | 3300025911 | Corn Rhizosphere | GRRQGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK |
| Ga0207707_105808702 | 3300025912 | Corn Rhizosphere | MPAFGGIMPAAGIWNVVTYLQSLEPPNDMPTEPWK |
| Ga0207695_116264061 | 3300025913 | Corn Rhizosphere | RRQGMPAFGGIMPAAGIWKVVTYLQSLEPPNDVPTESWK |
| Ga0207671_106889761 | 3300025914 | Corn Rhizosphere | SAGEIFSSIYYGRRQGMPAFGGLMPAAGIWKVVTYLQSLEPPNDVPTESWK |
| Ga0207698_121947112 | 3300026142 | Corn Rhizosphere | IFSSIYAGRRQGMPAFGGIMPAAGIWKLVTYLQSLEPPNDVPTESWK |
| Ga0209237_11407242 | 3300026297 | Grasslands Soil | PRGMPAFGGILPPDAIWKLATYLQSLEPKQDISTVSW |
| Ga0209237_11842451 | 3300026297 | Grasslands Soil | MPAFGGILSPDAIWKLVTYVQSLEPPADVPTERWP |
| Ga0209236_10600363 | 3300026298 | Grasslands Soil | HGMPAYGGLLPPGAIWKVVTYLQSLEPPANVPTQSWK |
| Ga0209239_10069062 | 3300026310 | Grasslands Soil | MSNFVHPHGMPAYGELLLAPEAVWKLVTDIQSLEPPADLPTEVWK |
| Ga0209239_10593471 | 3300026310 | Grasslands Soil | GGADGAIFQSIYYGRPRGMPAFGGLLPPDAIWKLVTYLQGLAPAVDPATVSW |
| Ga0209239_12279631 | 3300026310 | Grasslands Soil | ELFQSIYYGRPHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADVPTEAWQ |
| Ga0209472_11913492 | 3300026323 | Soil | MSNFVHPHGMPAYGGLLLAPEAVWKLVTDIQSLEPS |
| Ga0209152_100944082 | 3300026325 | Soil | YGRPRGMPAFGGLLPPDAIWKLVTYLQGLAPAVDPATASW |
| Ga0209152_103821572 | 3300026325 | Soil | RPRGMPAFGGVLPPDAIWRLVTYLQGLEPAADPSTTSW |
| Ga0209801_11390853 | 3300026326 | Soil | DGALFQSIYYGRPRGMPAFGGVLAPDAVWKLVTYLQSLEPPVDVPTERWR |
| Ga0209801_11889093 | 3300026326 | Soil | HGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWR |
| Ga0209267_12570321 | 3300026331 | Soil | PRGMPAFGGILPPEAIWKLVTYLHSLEPKQDISTVSW |
| Ga0209377_100091314 | 3300026334 | Soil | MPAFGGILSPDAIWKLVTYLQSLEPPADVPTERWP |
| Ga0209057_10668871 | 3300026342 | Soil | PHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK |
| Ga0209059_12634761 | 3300026527 | Soil | IYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLEPAADPSTTSW |
| Ga0209807_10466561 | 3300026530 | Soil | PHGMPAYGGLLLAPDAVWKLVTYIQSLEPPADLPTEAWH |
| Ga0209156_104019891 | 3300026547 | Soil | EIFRSIYYGQPHGMPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK |
| Ga0209161_100433511 | 3300026548 | Soil | MPAYGGLLPAGAIWKVVTYLQLLEPPANVPTQSWK |
| Ga0209474_106571942 | 3300026550 | Soil | HSVYYGRPRGMPAFGGVLPPDAIWKLVTYLQGLTPAVDPATVAW |
| Ga0209577_106548042 | 3300026552 | Soil | MSNFVHPHGMPAYGELLLAPEAVWKLVTDIQSLEPSAGLPTEVWT |
| Ga0209073_101768211 | 3300027765 | Agricultural Soil | YGRPHGMPAYGGLLLSSDAVWKLVTYLQSLAPPADVPTEAWDTSGR |
| Ga0209180_100475964 | 3300027846 | Vadose Zone Soil | CYGQPHGMPAYGGLLPPDAIWKLVTYLQSLEPPADVPTQTWR |
| Ga0209180_100624551 | 3300027846 | Vadose Zone Soil | FESIYYGRPHGMPAYGGLLLSPGAVWKLVTYLQALEPPEDVPTERWK |
| Ga0137415_109713031 | 3300028536 | Vadose Zone Soil | YGRPHGMPAYGGLLQTADAVWPLVTYLQSLTPPADVPTESWLPPPP |
| Ga0307282_104805392 | 3300028784 | Soil | IYYGRPHGMPAYGGLLLSPDAVWKLVTYLQALEPPADVPTEAWP |
| Ga0308194_101210911 | 3300031421 | Soil | MPAYGGLLLSPDAVWKLVTYLQALEPPADVPTEAWP |
| Ga0307473_106265272 | 3300031820 | Hardwood Forest Soil | IFQSIYYGQAHGMPAYGGLLPPGAIWKLVTYLQSLAPPANVPTQSWK |
| Ga0307470_105740403 | 3300032174 | Hardwood Forest Soil | HGMPAYGGLLSSDVVWKLVTYLESLQPPPDLPTEAWDTSAR |
| Ga0364924_099600_1_132 | 3300033811 | Sediment | SISSGRPKGMPAFGGLLSPEIIWKLVTYLQSLPVPKSVPTQAW |
| ⦗Top⦘ |