Metagenome / Metatranscriptome Family F091644

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F091644
Family Type	Metagenome / Metatranscriptome
Number of Sequences	107
Average Sequence Length	39 residues
Representative Sequence	MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA
Number of Associated Samples	86
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	4.63 %
% of genes near scaffold ends (potentially truncated)	79.44 %
% of genes from short scaffolds (< 2000 bps)	85.05 %
Associated GOLD sequencing projects	83
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (73.832 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.430 % of family members)
Environment Ontology (ENVO)	Unclassified (41.121 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (35.514 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF13392	HNH_3	5.61
PF13640	2OG-FeII_Oxy_3	3.74
PF13759	2OG-FeII_Oxy_5	3.74
PF13884	Peptidase_S74	2.80
PF13589	HATPase_c_3	0.93
PF00149	Metallophos	0.93
PF13385	Laminin_G_3	0.93
PF01367	5_3_exonuc	0.93
PF11651	P22_CoatProtein	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG0258	5'-3' exonuclease Xni/ExoIX (flap endonuclease)	Replication, recombination and repair [L]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
All Organisms	root	All Organisms	26.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
Viruses	superkingdom	All Organisms → Viruses	21.50 %
cellular organisms	root	All Organisms → cellular organisms	4.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	14.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	4.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	14.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.80 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	14.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.93 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	14.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Thiotrichales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales	0.93 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	13.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.93 %
unclassified Thiotrichales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales	0.93 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.93 %
Thiotrichales bacterium SG8_50	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Cyanobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	0.93 %
Thiotrichales bacterium SG8_50	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
unclassified Cyanobium	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium	0.93 %
Thiotrichales bacterium SG8_50	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	73.83 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.54 %
Cyanobium sp. CH-040	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. CH-040	0.93 %
Thiotrichales bacterium SG8_50	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2022920000\|QLn_FQAYR3Y02QKR01	Not Available	515	Open in IMG/M
3300001968\|GOS2236_1075691	Not Available	1842	Open in IMG/M
3300002161\|JGI24766J26685_10092195	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	648	Open in IMG/M
3300002200\|metazooDRAFT_1278037	Not Available	880	Open in IMG/M
3300002408\|B570J29032_109815313	All Organisms → Viruses → Predicted Viral	1443	Open in IMG/M
3300002835\|B570J40625_100161830	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2523	Open in IMG/M
3300005582\|Ga0049080_10080385	Not Available	1115	Open in IMG/M
3300005582\|Ga0049080_10101333	Not Available	979	Open in IMG/M
3300005583\|Ga0049085_10141081	Not Available	816	Open in IMG/M
3300005805\|Ga0079957_1254574	All Organisms → cellular organisms → Bacteria	813	Open in IMG/M
3300006802\|Ga0070749_10006292	Not Available	7786	Open in IMG/M
3300006802\|Ga0070749_10053863	Not Available	2444	Open in IMG/M
3300006802\|Ga0070749_10281883	Not Available	935	Open in IMG/M
3300006802\|Ga0070749_10348553	All Organisms → Viruses	823	Open in IMG/M
3300006802\|Ga0070749_10509754	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	655	Open in IMG/M
3300006802\|Ga0070749_10587870	Not Available	601	Open in IMG/M
3300006863\|Ga0075459_1023222	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1033	Open in IMG/M
3300007177\|Ga0102978_1184644	All Organisms → Viruses → Predicted Viral	2102	Open in IMG/M
3300007234\|Ga0075460_10257441	Not Available	580	Open in IMG/M
3300007344\|Ga0070745_1174540	Not Available	804	Open in IMG/M
3300007346\|Ga0070753_1289027	Not Available	588	Open in IMG/M
3300007363\|Ga0075458_10129291	Not Available	784	Open in IMG/M
3300007539\|Ga0099849_1244473	Not Available	661	Open in IMG/M
3300007540\|Ga0099847_1149907	Not Available	694	Open in IMG/M
3300007541\|Ga0099848_1291162	Not Available	562	Open in IMG/M
3300007542\|Ga0099846_1307429	Not Available	542	Open in IMG/M
3300007640\|Ga0070751_1378637	Not Available	513	Open in IMG/M
3300008116\|Ga0114350_1057960	All Organisms → Viruses → Predicted Viral	1374	Open in IMG/M
3300008116\|Ga0114350_1160843	Not Available	610	Open in IMG/M
3300008266\|Ga0114363_1230208	Not Available	540	Open in IMG/M
3300008448\|Ga0114876_1183572	Not Available	725	Open in IMG/M
3300009149\|Ga0114918_10274400	Not Available	951	Open in IMG/M
3300010300\|Ga0129351_1225479	Not Available	721	Open in IMG/M
3300010318\|Ga0136656_1276839	Not Available	548	Open in IMG/M
3300010368\|Ga0129324_10304056	Not Available	627	Open in IMG/M
3300010370\|Ga0129336_10312037	Not Available	872	Open in IMG/M
3300010370\|Ga0129336_10371493	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	784	Open in IMG/M
3300010370\|Ga0129336_10589981	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	594	Open in IMG/M
3300010389\|Ga0136549_10148506	Not Available	1055	Open in IMG/M
3300010885\|Ga0133913_10005524	Not Available	32559	Open in IMG/M
3300012012\|Ga0153799_1069933	Not Available	634	Open in IMG/M
3300012017\|Ga0153801_1074527	Not Available	596	Open in IMG/M
3300012726\|Ga0157597_1207745	Not Available	541	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10653786	Not Available	558	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10161973	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1572	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10424619	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	901	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10743104	Not Available	615	Open in IMG/M
3300017736\|Ga0181365_1002430	All Organisms → Viruses → Predicted Viral	4483	Open in IMG/M
3300017747\|Ga0181352_1170991	Not Available	567	Open in IMG/M
3300017754\|Ga0181344_1082861	All Organisms → cellular organisms → Bacteria → Proteobacteria	941	Open in IMG/M
3300017761\|Ga0181356_1035060	Not Available	1782	Open in IMG/M
3300017766\|Ga0181343_1097881	Not Available	834	Open in IMG/M
3300017774\|Ga0181358_1080908	Not Available	1186	Open in IMG/M
3300017788\|Ga0169931_10779281	Not Available	617	Open in IMG/M
3300017991\|Ga0180434_10879628	Not Available	675	Open in IMG/M
3300018080\|Ga0180433_10495279	Not Available	930	Open in IMG/M
3300018080\|Ga0180433_10596401	Not Available	830	Open in IMG/M
3300018080\|Ga0180433_10852571	Not Available	670	Open in IMG/M
3300018080\|Ga0180433_10998780	Not Available	611	Open in IMG/M
3300019783\|Ga0181361_105388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50	976	Open in IMG/M
3300020204\|Ga0194116_10003715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18148	Open in IMG/M
3300020551\|Ga0208360_1038825	Not Available	608	Open in IMG/M
3300021376\|Ga0194130_10294113	Not Available	905	Open in IMG/M
3300023179\|Ga0214923_10082980	Not Available	2244	Open in IMG/M
3300023179\|Ga0214923_10577238	Not Available	536	Open in IMG/M
3300024262\|Ga0210003_1358804	Not Available	540	Open in IMG/M
3300024433\|Ga0209986_10346326	Not Available	690	Open in IMG/M
3300024510\|Ga0255187_1031326	Not Available	734	Open in IMG/M
3300024550\|Ga0255266_1131665	Not Available	573	Open in IMG/M
3300024860\|Ga0256344_1093852	Not Available	648	Open in IMG/M
3300025635\|Ga0208147_1000761	All Organisms → cellular organisms → Bacteria → Proteobacteria	10867	Open in IMG/M
3300025889\|Ga0208644_1009831	Not Available	6625	Open in IMG/M
3300025889\|Ga0208644_1243726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	748	Open in IMG/M
3300025889\|Ga0208644_1366341	Not Available	543	Open in IMG/M
3300025896\|Ga0208916_10173363	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	930	Open in IMG/M
3300026473\|Ga0255166_1007853	Not Available	2439	Open in IMG/M
3300027688\|Ga0209553_1268578	Not Available	527	Open in IMG/M
3300027888\|Ga0209635_11147343	Not Available	522	Open in IMG/M
3300027917\|Ga0209536_101364067	Not Available	866	Open in IMG/M
3300028025\|Ga0247723_1136932	Not Available	584	Open in IMG/M
3300031565\|Ga0307379_11192972	Not Available	632	Open in IMG/M
3300031565\|Ga0307379_11418195	Not Available	559	Open in IMG/M
3300031673\|Ga0307377_10812759	Not Available	646	Open in IMG/M
3300031673\|Ga0307377_10898574	Not Available	604	Open in IMG/M
3300031758\|Ga0315907_10460693	Not Available	1013	Open in IMG/M
3300031857\|Ga0315909_10344071	Not Available	1093	Open in IMG/M
3300031951\|Ga0315904_10295233	Not Available	1522	Open in IMG/M
3300032046\|Ga0315289_11463811	Not Available	524	Open in IMG/M
3300032053\|Ga0315284_12315601	Not Available	530	Open in IMG/M
3300033980\|Ga0334981_0489830	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300033981\|Ga0334982_0084816	All Organisms → Viruses → Predicted Viral	1691	Open in IMG/M
3300033993\|Ga0334994_0060443	Not Available	2331	Open in IMG/M
3300033997\|Ga0310131_095005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. CH-040	523	Open in IMG/M
3300034061\|Ga0334987_0108257	All Organisms → Viruses → Predicted Viral	2121	Open in IMG/M
3300034062\|Ga0334995_0201911	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1381	Open in IMG/M
3300034063\|Ga0335000_0209075	All Organisms → Viruses → Predicted Viral	1252	Open in IMG/M
3300034063\|Ga0335000_0376605	Not Available	851	Open in IMG/M
3300034063\|Ga0335000_0564936	Not Available	645	Open in IMG/M
3300034073\|Ga0310130_0013724	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2730	Open in IMG/M
3300034106\|Ga0335036_0846030	Not Available	525	Open in IMG/M
3300034109\|Ga0335051_0237410	Not Available	900	Open in IMG/M
3300034112\|Ga0335066_0077562	Not Available	2144	Open in IMG/M
3300034166\|Ga0335016_0640155	Not Available	574	Open in IMG/M
3300034200\|Ga0335065_0569613	Not Available	666	Open in IMG/M
3300034272\|Ga0335049_0098333	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2134	Open in IMG/M
3300034356\|Ga0335048_0539889	Not Available	551	Open in IMG/M
3300034356\|Ga0335048_0613994	Not Available	502	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	93.46%
Terrestrial	Environmental → Terrestrial	6.54%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	56.07%
Marine	Environmental → Aquatic → Marine	30.84%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	5.61%
Soil	Environmental → Terrestrial → Soil	3.74%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.80%
Sediment	Environmental → Aquatic → Sediment	0.93%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	34.58%
Coastal	Environmental → Aquatic → Marine → Coastal	25.23%
Lentic	Environmental → Aquatic → Freshwater → Lentic	14.95%
Oceanic	Environmental → Aquatic → Marine → Oceanic	4.67%
Hypersaline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline	4.67%
River	Environmental → Aquatic → Freshwater → River	3.74%
Clay	Environmental → Terrestrial → Soil → Clay	3.74%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.80%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.80%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.93%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	32.71%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	25.23%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	12.15%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	4.67%
Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment	4.67%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	3.74%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	3.74%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.80%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.80%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.80%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.87%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	22.43%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	19.63%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	7.48%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	5.61%
Hypersaline Lake Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment	4.67%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.74%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	3.74%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	3.74%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.80%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.80%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.80%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	2.80%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.87%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.87%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.87%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	1.87%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	1.87%
Lake	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.93%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.93%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.93%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.93%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.93%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.93%
Marine Methane Seep Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment	0.93%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2022920000	Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled)	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002200	Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006863	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA	Environmental	Open in IMG/M
3300007177	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects	Environmental	Open in IMG/M
3300007234	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA	Environmental	Open in IMG/M
3300007344	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4	Environmental	Open in IMG/M
3300007346	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31	Environmental	Open in IMG/M
3300007363	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA	Environmental	Open in IMG/M
3300007539	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG	Environmental	Open in IMG/M
3300007540	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300007640	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009149	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG	Environmental	Open in IMG/M
3300010300	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA	Environmental	Open in IMG/M
3300010318	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010389	Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012726	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300017991	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG	Environmental	Open in IMG/M
3300018080	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG	Environmental	Open in IMG/M
3300019783	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N	Environmental	Open in IMG/M
3300020204	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface	Environmental	Open in IMG/M
3300020551	Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300024262	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)	Environmental	Open in IMG/M
3300024433	Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)	Environmental	Open in IMG/M
3300024510	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h	Environmental	Open in IMG/M
3300024550	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024860	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025635	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025889	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026473	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d	Environmental	Open in IMG/M
3300027688	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)	Environmental	Open in IMG/M
3300027888	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031673	Soil microbial communities from Risofladan, Vaasa, Finland - TR-3	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033997	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034109	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034166	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
QL_na_1184210	2022920000	Saline Water	MVEEVQGDQTRISLSFNTFPIGSIGEEVDLTGLKI
GOS2236_10756914	3300001968	Marine	PSHLTHMVETLKGDDVRVSMSFNTFPTGHIGDDDNLTGLEL*
JGI24766J26685_100921953	3300002161	Freshwater And Sediment	THMVETVQGDERVSLAFNTFPVGYVGEEESLTALHLRN*
metazooDRAFT_12780373	3300002200	Lake	VEAKQGENIRTSLAFNTFPVGQVGENLDMTGLDL*
B570J29032_1098153135	3300002408	Freshwater	HMVPNVQGETTRISLSFNTFPVGTVGEEMDLTGLKLEA*
B570J40625_1001618301	3300002835	Freshwater	THMVQTVQGEDTRISLSFNTFPVGYVGDEKSLTGLHLRD*
Ga0049080_100803851	3300005582	Freshwater Lentic	VPTLQGEDQRVSMSFNTFPVGYVGSDDDLTGLRL*
Ga0049080_101013334	3300005582	Freshwater Lentic	MLFPSSLTHMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE*
Ga0049085_101410811	3300005583	Freshwater Lentic	LTHMVETIQGPETRISLSFNSFPTGYLGDEDDLTRLDIE*
Ga0079957_12545741	3300005805	Lake	LMLFPSSLTHMVETVQGDERVSLAFNTFPVGYVGEEESLTALHI*
Ga0070749_100062921	3300006802	Aqueous	MVETVQGDERVSLSYNTFPVGYVGEEESLTALHLEN*
Ga0070749_100538634	3300006802	Aqueous	HMVETVQGNDTRISLSFNTFPVGNFGQDESLTGLHL*
Ga0070749_102818831	3300006802	Aqueous	MVETVQGESTRISLSFNTFPVGNIGEEVDLTGLKLETAKG*
Ga0070749_103485532	3300006802	Aqueous	MVEGVKGDHTRISLSFNTFPVGLVGEEVDLTALRLEDVER*
Ga0070749_105097541	3300006802	Aqueous	SLTHMVEAVQQERVSLSFNTFPVGYVGEEESLTALHLENPQGAA*
Ga0070749_105878702	3300006802	Aqueous	MFPVEGENTRISMSFNTFPVGSVGDEMELTGLKLEA*
Ga0075459_10232221	3300006863	Aqueous	MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA*
Ga0102978_11846446	3300007177	Freshwater Lake	VPEVKGDDVRISLSFNTFPVGVVGEEMDLTGLKLEA*
Ga0075460_102574411	3300007234	Aqueous	PSSLTHMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE*
Ga0070745_11745402	3300007344	Aqueous	MVPEVKGDDTRISLSFNTFPVGVVGEEMDLTGLRLEA*
Ga0070753_12890271	3300007346	Aqueous	ETVQGDERISLSFNTFPVGLAGSEESLTALHLRD*
Ga0075458_101292911	3300007363	Aqueous	MLFPSSLTHMVETVQGDERVSLAFNTFPVGYVGDEENLTALHLRN*
Ga0099849_12444731	3300007539	Aqueous	VETVQGDQTRISLSFNTFPIGLVGDEMNLTGLQLESVKG*
Ga0099847_11499071	3300007540	Aqueous	QGDQTRISLSFNTFPIGLVGDEMNLTGLQLESVKG*
Ga0099848_12911621	3300007541	Aqueous	THMVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLEAAKG*
Ga0099846_13074291	3300007542	Aqueous	MVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE*
Ga0070751_13786371	3300007640	Aqueous	ETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE*
Ga0114350_10579601	3300008116	Freshwater, Plankton	TVKGDDVRISMSFNTFPVGVVGDELSLTGLKLEA*
Ga0114350_11608431	3300008116	Freshwater, Plankton	EVKGDDTRISLSFNTFPVGVVGEEMDLTGLKLEA*
Ga0114363_12302082	3300008266	Freshwater, Plankton	VQQERVSLSFNTFPVGYVGEEESLTALHLENPQGAA*
Ga0114876_11835722	3300008448	Freshwater Lake	MVPNVQGETTRISLSFNTFPVGTVGEEMDLTGLKLEA*
Ga0114918_102744004	3300009149	Deep Subsurface	GDQTRISLSFNTFPIGLVGDEMNLTGLQLESVKG*
Ga0129351_12254793	3300010300	Freshwater To Marine Saline Gradient	QGDQTRISLSFNTFPVGVVGEEMDLTGLKLEAVKG*
Ga0136656_12768391	3300010318	Freshwater To Marine Saline Gradient	LTHMVETVKEEDRISLSFNTFPVGYVGEEESLTALHLEN*
Ga0129324_103040561	3300010368	Freshwater To Marine Saline Gradient	TRISLSFNTFPIGLVGDEMNLTGLQIGELDGALR*
Ga0129336_103120371	3300010370	Freshwater To Marine Saline Gradient	TVEGEDVRVSLSFNTFPAGTVGEEMDLTGLKLEV*
Ga0129336_103714933	3300010370	Freshwater To Marine Saline Gradient	THMVPTVESEQTRISLSFNTFPVGNVGEEMDLTGLQLGELDGAFR*
Ga0129336_105899811	3300010370	Freshwater To Marine Saline Gradient	NVPPVEGENTRISMSFNTFPVGSVGDEMELTGLKLEA*
Ga0136549_101485064	3300010389	Marine Methane Seep Sediment	GEATRISLSFNTFPVGVVGEEMDLTGLKLETVKG*
Ga0133913_1000552435	3300010885	Freshwater Lake	SSFTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL*
Ga0153799_10699333	3300012012	Freshwater	HMVPTVEGEDVRVSLSFNTFPAGTVGEEMDLTGLKLEV*
Ga0153801_10745271	3300012017	Freshwater	LTHMVPTVESEQTRISLSFNTFPVGNVGEEVDLTGLQLGELDGAFR*
Ga0157597_12077452	3300012726	Freshwater	LEHNVPTVQGDDVRISMSFNTFPVGVVGDELSLTGLKLEA*
(restricted) Ga0172367_106537862	3300013126	Freshwater	LEHMVETVNAENTRISLSFNTFPVGIVGEEKDLTLLELT*
(restricted) Ga0172373_101619731	3300013131	Freshwater	THMVESVQQERVSLSFNTFPVGYVGEEESLTALHLEN*
(restricted) Ga0172372_104246193	3300013132	Freshwater	MVPTVEGEDVRVSLSFNTFPAGTVGEEMDLTGLKLEV*
(restricted) Ga0172372_107431041	3300013132	Freshwater	THMVQTVESEKTRISLAFNTFPVGHVGDEMNLTGLSLGELDGAFL*
Ga0181365_10024301	3300017736	Freshwater Lake	HMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL
Ga0181352_11709911	3300017747	Freshwater Lake	THMVETVQGDERVSLAFNTFPVGYVGEEESLTALHLRN
Ga0181344_10828611	3300017754	Freshwater Lake	THMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE
Ga0181356_10350605	3300017761	Freshwater Lake	PSSFTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL
Ga0181343_10978811	3300017766	Freshwater Lake	MVETVKGEDTRISLSFNTFPVGNIGEEVDLTGLKLESIKE
Ga0181358_10809084	3300017774	Freshwater Lake	FTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL
Ga0169931_107792811	3300017788	Freshwater	PSHLTHMVESVQQERVSLSFNTFPVGYVGEEESLTALHLEN
Ga0180434_108796281	3300017991	Hypersaline Lake Sediment	THMVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE
Ga0180433_104952791	3300018080	Hypersaline Lake Sediment	HMVETVKGDQQRISLSFNTFPVGSVGDEMNLTGLQIGELDGALR
Ga0180433_105964013	3300018080	Hypersaline Lake Sediment	THMVETVQGNNTRISLSFNTFPVGNFGDDLSLTGLHL
Ga0180433_108525711	3300018080	Hypersaline Lake Sediment	MVETVQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE
Ga0180433_109987801	3300018080	Hypersaline Lake Sediment	VQGDQTRISLSFNTFPVGVVGEEMDLTGLKLEAVKG
Ga0181361_1053884	3300019783	Freshwater Lake	FPSSFTHMVEAVKGEDLRVSMSFNTFPVGYVGDDDSLTGLHL
Ga0194116_100037151	3300020204	Freshwater Lake	QTLDHDQTRISLAFNTFPIGHIGEEVDLTGLNLGELDGAFR
Ga0208360_10388251	3300020551	Freshwater	SSLEHNVPTVQGEDVRISMSFNTFPVGIVGDEMQLTGLKLEA
Ga0194130_102941133	3300021376	Freshwater Lake	VQGDQTRISLSFNTFPVGSVGDEMNLTGLQLESVKG
Ga0214923_100829803	3300023179	Freshwater	MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLRLEA
Ga0214923_105772382	3300023179	Freshwater	PEVKGEDTRISLSFNTFPVGVVGEEMDLTGLRLEA
Ga0210003_13588042	3300024262	Deep Subsurface	ETVKGEDTRISLSFNTFPVGLVGEEMDLTGLKLESIKE
Ga0209986_103463261	3300024433	Deep Subsurface	VQGEATRISLSFNTFPVGVVGEEMDLTGLKLEAVKG
Ga0255187_10313262	3300024510	Freshwater	MLFPSSLTHMVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE
Ga0255266_11316651	3300024550	Freshwater	VPEIKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEI
Ga0256344_10938522	3300024860	Freshwater	MVPTIEGDDTRISLSFNTFPVGVVGEEMDLTGLKLEA
Ga0208147_10007619	3300025635	Aqueous	MVPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA
Ga0208644_10098314	3300025889	Aqueous	MVETVKEEDRISLSFNTFPVGYVGEEESLTALHLEQ
Ga0208644_12437261	3300025889	Aqueous	VPEVKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEA
Ga0208644_13663412	3300025889	Aqueous	VQGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE
Ga0208916_101733633	3300025896	Aqueous	PTVQGEQTRISLSFNTFPVGTVGEEMDLTGLKLEA
Ga0255166_10078532	3300026473	Freshwater	MVQTVESDQTRISLAFNTFPVGNIGEELDLTGLQLGELDGAFR
Ga0209553_12685782	3300027688	Freshwater Lake	SLTHMVPTLQGEDQRVSMSFNTFPVGYVGSDDDLTGLRL
Ga0209635_111473431	3300027888	Marine Sediment	LTHMVETVQGDQQRISLSFNTFPVGLVGDEMNLTGLQIGELDGALR
Ga0209536_1013640671	3300027917	Marine Sediment	QGDQTRISLSFNTFPVGVVGEEMDLTGLKLESVKE
Ga0247723_11369321	3300028025	Deep Subsurface Sediment	SLEHNVPTVQGNDVRISMSFNTFPVGIVGDEMSLTGLKLEV
Ga0307379_111929721	3300031565	Soil	HMVETVKGEDTRVSLSFNTFPVGLVGEEMDLTGLKLESIKE
Ga0307379_114181951	3300031565	Soil	MVETVQGDQTRISLSFNTFPIGLVGDEMNLTGLQIGELDGALR
Ga0307377_108127593	3300031673	Soil	HMVETVKGEDTRISLSFNTFPVGLVGEEMDLTGLKLESIKE
Ga0307377_108985743	3300031673	Soil	VQGEATRISLSFNTFPVGVVGEEMDLTGLKLETVKG
Ga0315907_104606934	3300031758	Freshwater	VETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE
Ga0315909_103440711	3300031857	Freshwater	SLTHMVETVQGEDRVSLAFNTFPVGYVGEEESLTALHLKE
Ga0315904_102952335	3300031951	Freshwater	MVETVQGDDRVSLAFNTFPAGYVGDESSLTALHLKE
Ga0315289_114638112	3300032046	Sediment	THMVPTLQGDDQRVSMSFNTFPVGYVGSDDDLTGLRL
Ga0315284_123156012	3300032053	Sediment	LTHMVPTLQGDDQRVSMSFNTFPVGYVGSDDDLTGLRL
Ga0334981_0489830_8_121	3300033980	Freshwater	MVPEVKGDDVRISLSFNTFPVGVVGEEMDLTGLKLEA
Ga0334982_0084816_1572_1691	3300033981	Freshwater	THMVQTVQGEDTRISLSFNTFPVGYVGDEKSLTGLHLRD
Ga0334994_0060443_1_111	3300033993	Freshwater	VQTVQGEDTRISLSFNTFPVGYVGDEKSLTGLHLRD
Ga0310131_095005_308_430	3300033997	Fracking Water	MVQTLDHHETRISLAFNTFPVGVVGEEMDLTSLKLETAQG
Ga0334987_0108257_940_1071	3300034061	Freshwater	MVPTVESEQTRISLSFNTFPVGNVGEEMDLTGLQLGELDGAFR
Ga0334995_0201911_1257_1379	3300034062	Freshwater	REHNVPTVQGEDVRISMSFNTFPVGIVGDEMQLTGLKLEA
Ga0335000_0209075_107_229	3300034063	Freshwater	MVETVKGEDTRISLSFNTFPVGLVGEEMDLTGLKLESIKE
Ga0335000_0376605_734_850	3300034063	Freshwater	THMVETVQGDDRVSLAFNTFPVGYVGEEEQLTALHLEN
Ga0335000_0564936_53_184	3300034063	Freshwater	MVPTVESEQTRISLSFNTFPVGNIGEEVDLTGLQLGELDGAFR
Ga0310130_0013724_2484_2597	3300034073	Fracking Water	MVPEIKGEDTRISLSFNTFPVGVVGEEMDLTGLKLEI
Ga0335036_0846030_67_180	3300034106	Freshwater	MVPTIQGEKTRISMSFNTFPVGTVGEEMELTGLKLEA
Ga0335051_0237410_784_900	3300034109	Freshwater	HNVPTAQGDDVRISMSFNTFPVGVVGDELSLTGLKLEA
Ga0335066_0077562_74_196	3300034112	Freshwater	MVETVKGEDTRISLSFNTFPVGNIGEEVDLTGLKLESAQG
Ga0335016_0640155_453_572	3300034166	Freshwater	EHNVPTVQGEDVRISMSFNTFPVGIVGDEMSLTGLKLEA
Ga0335065_0569613_1_117	3300034200	Freshwater	HMVPTIQGEQTRISLSFNTFPVGTVGEEMDLTGLKLEA
Ga0335049_0098333_1_117	3300034272	Freshwater	HNVPTVTGDDVRISMSFNTFPVGVVGDEMQLTGLKLEA
Ga0335048_0539889_163_294	3300034356	Freshwater	MVQTVESDQTRISLSFNTFPVGNVGEEMDLTGLQLGELDGAFR
Ga0335048_0613994_344_454	3300034356	Freshwater	MVEQVKGEDTRISLSFNTFPKGIIGDEIALTTLKLG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters