| Basic Information | |
|---|---|
| Family ID | F091595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCEVETSADG |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.39 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 84.11 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.271 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.299 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 14.71% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01967 | MoaC | 66.36 |
| PF03454 | MoeA_C | 24.30 |
| PF00709 | Adenylsucc_synt | 5.61 |
| PF00689 | Cation_ATPase_C | 0.93 |
| PF14579 | HHH_6 | 0.93 |
| PF01797 | Y1_Tnp | 0.93 |
| PF00085 | Thioredoxin | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 66.36 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 24.30 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 5.61 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.27 % |
| All Organisms | root | All Organisms | 46.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102I09PN | Not Available | 500 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10056615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1010 | Open in IMG/M |
| 3300001154|JGI12636J13339_1026728 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300003218|JGI26339J46600_10022057 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300004082|Ga0062384_100839601 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005332|Ga0066388_103353253 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005537|Ga0070730_10146232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300005557|Ga0066704_10014886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4438 | Open in IMG/M |
| 3300005558|Ga0066698_10795594 | Not Available | 613 | Open in IMG/M |
| 3300005569|Ga0066705_10059074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2179 | Open in IMG/M |
| 3300005586|Ga0066691_10164746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1280 | Open in IMG/M |
| 3300005591|Ga0070761_10045490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2467 | Open in IMG/M |
| 3300006804|Ga0079221_11375910 | Not Available | 560 | Open in IMG/M |
| 3300006871|Ga0075434_102598255 | Not Available | 507 | Open in IMG/M |
| 3300006954|Ga0079219_12091279 | Not Available | 542 | Open in IMG/M |
| 3300009137|Ga0066709_104628067 | Not Available | 503 | Open in IMG/M |
| 3300010341|Ga0074045_10507860 | Not Available | 774 | Open in IMG/M |
| 3300010361|Ga0126378_10785850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300010364|Ga0134066_10161852 | Not Available | 712 | Open in IMG/M |
| 3300010398|Ga0126383_13213602 | Not Available | 534 | Open in IMG/M |
| 3300012096|Ga0137389_10234753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1537 | Open in IMG/M |
| 3300012202|Ga0137363_10032016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3641 | Open in IMG/M |
| 3300012203|Ga0137399_11307538 | Not Available | 609 | Open in IMG/M |
| 3300012205|Ga0137362_10392989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300012205|Ga0137362_10907392 | Not Available | 752 | Open in IMG/M |
| 3300012210|Ga0137378_10817090 | Not Available | 845 | Open in IMG/M |
| 3300012361|Ga0137360_10113969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2091 | Open in IMG/M |
| 3300012361|Ga0137360_10492589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1042 | Open in IMG/M |
| 3300012362|Ga0137361_10104582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2469 | Open in IMG/M |
| 3300012685|Ga0137397_10517372 | Not Available | 889 | Open in IMG/M |
| 3300012917|Ga0137395_10502526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 873 | Open in IMG/M |
| 3300012924|Ga0137413_10930296 | Not Available | 677 | Open in IMG/M |
| 3300014153|Ga0181527_1103585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1332 | Open in IMG/M |
| 3300014154|Ga0134075_10054231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300015053|Ga0137405_1255976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300015168|Ga0167631_1050189 | Not Available | 685 | Open in IMG/M |
| 3300015242|Ga0137412_10013418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6631 | Open in IMG/M |
| 3300016341|Ga0182035_10090015 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300017659|Ga0134083_10164934 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300017928|Ga0187806_1132381 | Not Available | 814 | Open in IMG/M |
| 3300017930|Ga0187825_10240809 | Not Available | 661 | Open in IMG/M |
| 3300017933|Ga0187801_10367680 | Not Available | 594 | Open in IMG/M |
| 3300017970|Ga0187783_10536742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 847 | Open in IMG/M |
| 3300017972|Ga0187781_10424758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 950 | Open in IMG/M |
| 3300017998|Ga0187870_1082103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1283 | Open in IMG/M |
| 3300018058|Ga0187766_10482271 | Not Available | 832 | Open in IMG/M |
| 3300018088|Ga0187771_10277900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1400 | Open in IMG/M |
| 3300018088|Ga0187771_10667580 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300018090|Ga0187770_11258758 | Not Available | 599 | Open in IMG/M |
| 3300018482|Ga0066669_11565203 | Not Available | 601 | Open in IMG/M |
| 3300019786|Ga0182025_1011353 | Not Available | 515 | Open in IMG/M |
| 3300019789|Ga0137408_1376977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300020140|Ga0179590_1188511 | Not Available | 565 | Open in IMG/M |
| 3300020581|Ga0210399_10425027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1107 | Open in IMG/M |
| 3300020581|Ga0210399_11282629 | Not Available | 578 | Open in IMG/M |
| 3300020582|Ga0210395_10817520 | Not Available | 694 | Open in IMG/M |
| 3300020583|Ga0210401_10066042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3408 | Open in IMG/M |
| 3300021088|Ga0210404_10586103 | Not Available | 633 | Open in IMG/M |
| 3300021178|Ga0210408_11213801 | Not Available | 575 | Open in IMG/M |
| 3300021181|Ga0210388_10478842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1093 | Open in IMG/M |
| 3300021405|Ga0210387_10891986 | Not Available | 782 | Open in IMG/M |
| 3300021479|Ga0210410_10145709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
| 3300021479|Ga0210410_10583895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 993 | Open in IMG/M |
| 3300022508|Ga0222728_1099638 | Not Available | 549 | Open in IMG/M |
| 3300025469|Ga0208687_1064431 | Not Available | 851 | Open in IMG/M |
| 3300025928|Ga0207700_10024494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4177 | Open in IMG/M |
| 3300026214|Ga0209838_1071024 | Not Available | 526 | Open in IMG/M |
| 3300026320|Ga0209131_1165383 | Not Available | 1095 | Open in IMG/M |
| 3300026326|Ga0209801_1251092 | Not Available | 670 | Open in IMG/M |
| 3300026327|Ga0209266_1150933 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300026330|Ga0209473_1269439 | Not Available | 576 | Open in IMG/M |
| 3300026332|Ga0209803_1296673 | Not Available | 554 | Open in IMG/M |
| 3300026499|Ga0257181_1062305 | Not Available | 631 | Open in IMG/M |
| 3300026528|Ga0209378_1114932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300026831|Ga0207738_115237 | Not Available | 712 | Open in IMG/M |
| 3300027010|Ga0207839_1025622 | Not Available | 670 | Open in IMG/M |
| 3300027050|Ga0209325_1042392 | Not Available | 550 | Open in IMG/M |
| 3300027565|Ga0209219_1159172 | Not Available | 540 | Open in IMG/M |
| 3300027587|Ga0209220_1201388 | Not Available | 504 | Open in IMG/M |
| 3300027633|Ga0208988_1095767 | Not Available | 737 | Open in IMG/M |
| 3300027663|Ga0208990_1133923 | Not Available | 665 | Open in IMG/M |
| 3300027824|Ga0209040_10277483 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300027829|Ga0209773_10123345 | Not Available | 1075 | Open in IMG/M |
| 3300027862|Ga0209701_10061856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2384 | Open in IMG/M |
| 3300028047|Ga0209526_10130340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1766 | Open in IMG/M |
| 3300028047|Ga0209526_10655843 | Not Available | 666 | Open in IMG/M |
| 3300031474|Ga0170818_113505548 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300031573|Ga0310915_10077527 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300031682|Ga0318560_10146700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1247 | Open in IMG/M |
| 3300031747|Ga0318502_11024665 | Not Available | 504 | Open in IMG/M |
| 3300031777|Ga0318543_10008499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3497 | Open in IMG/M |
| 3300031777|Ga0318543_10218687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 847 | Open in IMG/M |
| 3300031782|Ga0318552_10439180 | Not Available | 666 | Open in IMG/M |
| 3300031823|Ga0307478_10647157 | Not Available | 885 | Open in IMG/M |
| 3300031897|Ga0318520_10549359 | Not Available | 716 | Open in IMG/M |
| 3300031897|Ga0318520_11051811 | Not Available | 515 | Open in IMG/M |
| 3300031941|Ga0310912_10193151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
| 3300031945|Ga0310913_10462792 | Not Available | 901 | Open in IMG/M |
| 3300031945|Ga0310913_10579546 | Not Available | 796 | Open in IMG/M |
| 3300031959|Ga0318530_10481304 | Not Available | 515 | Open in IMG/M |
| 3300032009|Ga0318563_10652710 | Not Available | 566 | Open in IMG/M |
| 3300032044|Ga0318558_10657452 | Not Available | 524 | Open in IMG/M |
| 3300032180|Ga0307471_103044760 | Not Available | 594 | Open in IMG/M |
| 3300032954|Ga0335083_11525414 | Not Available | 506 | Open in IMG/M |
| 3300032955|Ga0335076_10049894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4156 | Open in IMG/M |
| 3300033158|Ga0335077_10124135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2996 | Open in IMG/M |
| 3300033982|Ga0371487_0061233 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026831 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 9 (SPAdes) | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_06557940 | 2170459002 | Grass Soil | MSAAASSKTVKLLLADDNPLIRDLVSKGLDPFCES |
| AF_2010_repII_A1DRAFT_100566153 | 3300000597 | Forest Soil | MTTSGAKSVRLLLAEDNPLVGDLIVKGLDPFCVVEVCKD |
| JGI12636J13339_10267281 | 3300001154 | Forest Soil | MSSAAHKTVKLLLADDNPLVRELIVKGLEPVCEVETSTDGADAL |
| JGI26339J46600_100220571 | 3300003218 | Bog Forest Soil | MTAAPGKTVKLLLAEDNPLVRNLVSKALDPYCEVVIAGDGADALLKTI |
| Ga0062384_1008396011 | 3300004082 | Bog Forest Soil | MSAAAGKSVTLLLAEDNPLVRDLIAKALEPFCEVMIADDGGDALLKVIDEL |
| Ga0066388_1033532532 | 3300005332 | Tropical Forest Soil | MSAAASSKTVKLLLADDNPLIRDLVSKGLDPFCEVMICCDGADALL |
| Ga0070730_101462321 | 3300005537 | Surface Soil | LSPHGGKTVRLLLADDNPLVRDIVIKGLESHCEVIV |
| Ga0066704_100148861 | 3300005557 | Soil | MSAASGKSVKLLLAEDNPLVRDLIVKGLEPFCEVEVCKDGADALL |
| Ga0066698_107955941 | 3300005558 | Soil | MTTSIAKSVRLLLAEDNPLVRDLIVKGLDPFCLVEVCK |
| Ga0066705_100590741 | 3300005569 | Soil | MSASSSKSVRLLLAEDNPLVRDLIVKGLEPFCEIEVCQDGGDALLKVVDTPPDV |
| Ga0066691_101647463 | 3300005586 | Soil | MSSAGHKTVKLLLADDNPLVRELIVKGLETFCEVETSTDGA |
| Ga0070761_100454904 | 3300005591 | Soil | MSGAGGKTVKLLVADDNPLVRDLVAKGMEPYCEVE |
| Ga0079221_113759102 | 3300006804 | Agricultural Soil | MTGAGAKTVRMLLADDNPLVRDLVVKGMEPYCEIETANDGA |
| Ga0075434_1025982551 | 3300006871 | Populus Rhizosphere | MTTSGAKSVRLLLADDNPLVRDLILKGLEPFCEIEVCK |
| Ga0079219_120912792 | 3300006954 | Agricultural Soil | LSASSGRTVRLLVADDNPLVRDIVAKGMEPHCEVTIA |
| Ga0066709_1046280672 | 3300009137 | Grasslands Soil | MTSSGHKTTVKLLLADDNPLVRELIVKGLEAFCEVEVSTDGADALLK |
| Ga0074045_105078603 | 3300010341 | Bog Forest Soil | MTGTGAKTVKLLLADDNPLVRDLITKGMEPFCEVETAADG |
| Ga0126378_107858501 | 3300010361 | Tropical Forest Soil | MTTSGSKTAVKLLLAEDNPLVRDLIHKGLEPFCEIEMCKDGADALLKV |
| Ga0134066_101618521 | 3300010364 | Grasslands Soil | MTTSGSKTAVKLLLAEDNPLVRDLILKGLEPFCEIEVCKDGADAL |
| Ga0126383_132136022 | 3300010398 | Tropical Forest Soil | MSTAGAKSVKLLLAEDNPLVSDLIFKGLEPFCEVEVCK |
| Ga0137389_102347531 | 3300012096 | Vadose Zone Soil | MTTAGHKTIKLLLAEDNPLVRDLIVKGLEPFCAVETST |
| Ga0137363_100320165 | 3300012202 | Vadose Zone Soil | MSSAGHKTIKLLLADDNPLVRDLIVKGLEHFCEVEVSTD |
| Ga0137399_113075382 | 3300012203 | Vadose Zone Soil | MSTGGHKTVKLLLAEDNPLVRELIVKGLEPFCEIETS |
| Ga0137362_103929893 | 3300012205 | Vadose Zone Soil | LSAASGTKVRLLLADDNPLVRDIVVKGMEPHCDVIVATDGADAL |
| Ga0137362_109073923 | 3300012205 | Vadose Zone Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCEVETSADGADALL |
| Ga0137378_108170903 | 3300012210 | Vadose Zone Soil | MTTSGSKTAVKLLLAEDNPLVRDLIHKGLEPFCEVEMCKDGADALMKVV |
| Ga0137360_101139694 | 3300012361 | Vadose Zone Soil | MTTAGHKTIKLLLADDNPLVRELIVKGLEPICQNKGCTDGSDSFLKVVDTAPNGIPC |
| Ga0137360_104925891 | 3300012361 | Vadose Zone Soil | MTSAASKSVKLLLADDNPLMRDLISKSLEHFCEVVIASDGA |
| Ga0137361_101045821 | 3300012362 | Vadose Zone Soil | MTTTGHKSIKLLLADDNPLVRDLIVKGLEPFCEVET |
| Ga0137397_105173723 | 3300012685 | Vadose Zone Soil | MTPTSGKTVKLLLADDNPLMRDLVSKSLEPFCEVLIANDGADA |
| Ga0137395_105025261 | 3300012917 | Vadose Zone Soil | MSTGGHKSIRLLLADDNPLVRELIVKGLDAVCEVETS |
| Ga0137413_109302962 | 3300012924 | Vadose Zone Soil | MTSAASKSVKLLLADDNPLMRDLISKSLEHFCEVVIA |
| Ga0181527_11035853 | 3300014153 | Bog | MTAAPVKTVKLLLAEDNPLIRALVSKALDPYCEVMIAADGAD |
| Ga0134075_100542311 | 3300014154 | Grasslands Soil | MSAASGKSIKLLLAEDNPLVRELIVKGLEPFCDVETSADGTDALLKV |
| Ga0137405_12559761 | 3300015053 | Vadose Zone Soil | MSTSGHKTVKLLLADDNPLVRDLIIKGLESYCEVESSNCEV |
| Ga0167631_10501891 | 3300015168 | Glacier Forefield Soil | MSAASGKSIKLLLAEDNPLIRDLVLKALEPVCEVV |
| Ga0137412_100134181 | 3300015242 | Vadose Zone Soil | LSAVGGKTVRLLLADDNPLVRDIVAKGMEPHCEVTIAT |
| Ga0182035_100900154 | 3300016341 | Soil | MTTSGSKSVRLLLAEDNPLVRDLIVKGLDPFCVVEVCKDG |
| Ga0134083_101649343 | 3300017659 | Grasslands Soil | MSAASGKSIKLLLAEDNPMVRELIVKGLEPFCDVE |
| Ga0187806_11323811 | 3300017928 | Freshwater Sediment | MSAAPGKSVKLLVAEDNPMVRDLVAKGLEPFCEVMIADD |
| Ga0187825_102408091 | 3300017930 | Freshwater Sediment | MTGAGSKTVKLLLAEDNPLVRDLVSKGLEPFCEVLVANDGGDALLKVI |
| Ga0187801_103676802 | 3300017933 | Freshwater Sediment | MSAAASKSVKLLLAEDNPMVRDLVTRGLEPYCEVLVAT |
| Ga0187783_105367423 | 3300017970 | Tropical Peatland | MTAAAGKTVKLLLAEDNPMVRDLIVKGLEPFCEVMVA |
| Ga0187781_104247583 | 3300017972 | Tropical Peatland | MSAASSKTVKLLVAEDNPMVRDLVAKGLEPFCEVFVAADG |
| Ga0187870_10821031 | 3300017998 | Peatland | MTAAPSKTVKLLLAEDNPLVRALVSKALDPYCEVMTAADGAD |
| Ga0187766_104822711 | 3300018058 | Tropical Peatland | MSAAPGKSVKLLVAEDNPMVRDLVAKGLEPFCEVMIAADGAD |
| Ga0187771_102779001 | 3300018088 | Tropical Peatland | MTAVASKTVKLLLAEDNPLVRALVSKALDPFCEVM |
| Ga0187771_106675803 | 3300018088 | Tropical Peatland | MTAAPSKTVKLLLAEDNPLVRALVSKALDPFCEVMIA |
| Ga0187770_112587581 | 3300018090 | Tropical Peatland | MTAAPGKTVKLLLAEDNPLVRALVSKALEPFCEVMIAADGA |
| Ga0066669_115652032 | 3300018482 | Grasslands Soil | MSTAAHKTVKLLLADDNPLVRELIVKGLEPFCEVETSTDGADAL |
| Ga0182025_10113532 | 3300019786 | Permafrost | MSAAAGGKNIKLLLADDNPLIRDLVSKALDSVCEVVPADD |
| Ga0137408_13769772 | 3300019789 | Vadose Zone Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCEIETSATAQTLCSR |
| Ga0179590_11885112 | 3300020140 | Vadose Zone Soil | MTSTASKSVKLLLADDNPLMRDLISKSLEHFCEVVIASDGADALL |
| Ga0210399_104250273 | 3300020581 | Soil | MSTAAHKTVKLLLADDNPLVRELIVKGLDAVCEVETSTD |
| Ga0210399_112826291 | 3300020581 | Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGMEAYCEVETATDGAD |
| Ga0210395_108175201 | 3300020582 | Soil | MSAAAGKSIKLLLADDNPLIRDLVYKALEPFCEVVLADDGADA |
| Ga0210401_100660421 | 3300020583 | Soil | MTAAAGKTVKLLLADDNPLMRDLVSKSLEPFCEVVIASD |
| Ga0210404_105861031 | 3300021088 | Soil | MTAAAGKTVKLLLADDNPLMRDLVSKSLEPFCEVVIAADGA |
| Ga0210408_112138011 | 3300021178 | Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGMEPYCEVETATDGAD |
| Ga0210388_104788423 | 3300021181 | Soil | MSAAGGKSVKLLVADDNPLVRDLVVKGMEPYCEVETA |
| Ga0210387_108919861 | 3300021405 | Soil | MSAAASSKTVKLLLADDNPLIRDLVSKGLDPFCEIMICS |
| Ga0210410_101457094 | 3300021479 | Soil | MSAAAGKSVKLLLADDNPLVRDLIVKGMESFCEVET |
| Ga0210410_105838953 | 3300021479 | Soil | MTHAAGKTVKLLLADDNPLMRDLVSKSLEPFCDVVIASDGADALL |
| Ga0222728_10996381 | 3300022508 | Soil | MSAAGGKSVKLLLADDNPLVRDLIAKGLEPFCEVETSTDG |
| Ga0208687_10644311 | 3300025469 | Peatland | MTAAPSKTVKLLLAEDNPLVRALVSKALDPYCEVMTAA |
| Ga0207700_100244946 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LSASSGRTVRLLVADDNPLVRDIVAKGMEPHCDDTT |
| Ga0209838_10710241 | 3300026214 | Soil | MSAASGKSIKLLLAEDNPLIRDLVLKALEPVCEVVLADD |
| Ga0209131_11653831 | 3300026320 | Grasslands Soil | LTPSSGKRVRLLLADDNPLVREIVSKGMEPHCEVMI |
| Ga0209801_12510921 | 3300026326 | Soil | MSTAAHKTVKLLLADDNPLVRELIVKGLEPFCEVETSTDGADAILKVVD |
| Ga0209266_11509333 | 3300026327 | Soil | MSAASGKSIKLLLAEDNPLVRELIVKGLEPFCDVETSADGT |
| Ga0209473_12694392 | 3300026330 | Soil | MTTAGHKTIKLLLAEDNPLVRDLIVKGLEPFCLVEAS |
| Ga0209803_12966732 | 3300026332 | Soil | MSTGGHKTVKLLLADDNPLVRELIVKGLEPFCAVETSTDG |
| Ga0257181_10623052 | 3300026499 | Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCEVETSADG |
| Ga0209378_11149323 | 3300026528 | Soil | MTTAGHKTIKLLLAEDNPLVRDLIVKGLEPFCLVESSTDGADALLKVV |
| Ga0207738_1152371 | 3300026831 | Tropical Forest Soil | MSAAATKTVKLLLAEDNPMVRDLVTRGLEPFCEVIVAAD |
| Ga0207839_10256221 | 3300027010 | Tropical Forest Soil | MSAASGKTVKLLLAEDNPMVRDLVTHGLEPFCEVVIAADGA |
| Ga0209325_10423922 | 3300027050 | Forest Soil | MTTAGHKTIKLLLAEDNPLVRELIVKGLETFCEVEASTDGAD |
| Ga0209219_11591721 | 3300027565 | Forest Soil | MSAAGKSIKLLLADDNPLIRDLVCKALEPICEVVLA |
| Ga0209220_12013881 | 3300027587 | Forest Soil | MSAAGKNIKLLLADDNPLIRDLVCKALEPICEVVLADDGADALLK |
| Ga0208988_10957673 | 3300027633 | Forest Soil | MSAAGKSIKLLLADDNPLIRDLVCKALEPICEVVLADDGADA |
| Ga0208990_11339231 | 3300027663 | Forest Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCEVETSKDGADALIK |
| Ga0209040_102774831 | 3300027824 | Bog Forest Soil | MSGAGAKTVKLLVADDNPLVRDLVVKGMEPYCEVETA |
| Ga0209773_101233451 | 3300027829 | Bog Forest Soil | MSAAGGKTVKLLVADDNPLVRDLIIKGMEPYCEVETA |
| Ga0209701_100618564 | 3300027862 | Vadose Zone Soil | MTAASGKSIKLLLAEDNPLVRDLIVKGLEPYCEIDVS |
| Ga0209526_101303401 | 3300028047 | Forest Soil | MSAAAGKSIKLLLADDNPLIRELVLKALEPVCEVVLAADGADALLKV |
| Ga0209526_106558431 | 3300028047 | Forest Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCDIETCTDGADALL |
| Ga0170818_1135055481 | 3300031474 | Forest Soil | MNPTSGKTVKLLLADDNPLMRDLVSKSLEPFCEVLIANDGADA |
| Ga0310915_100775271 | 3300031573 | Soil | MTTSSAKSVRLLLAEDNPLVRDLIVKGLDPFCVVEVC |
| Ga0318560_101467001 | 3300031682 | Soil | MSAAGGKSVRLLVAEDNPMVRDLVSKGLEPFCEVLVAND |
| Ga0318502_110246651 | 3300031747 | Soil | MSAAATKTVKLLLAEDNPMVRDLVTRGLEAFCEVIVAAD |
| Ga0318543_100084991 | 3300031777 | Soil | MTTSSAKSVRLLLAEDNPLVRDLIVKGLDPFCVVEVCR |
| Ga0318543_102186873 | 3300031777 | Soil | MSAASGKTVKLLLAEDNPMVRELVAKGLEPFCEVASAN |
| Ga0318552_104391801 | 3300031782 | Soil | MTTSSAKSVRLLLAEDNPLVRDLIVKGLDPFCVVEVCK |
| Ga0307478_106471571 | 3300031823 | Hardwood Forest Soil | MTSAASKSVRLLLADDNPLMRDLISKSLEHFCEVVIASDGADA |
| Ga0318520_105493592 | 3300031897 | Soil | MSAASGKSVKLLVAEDNPMVRDLVSKGLEPFCEVL |
| Ga0318520_110518111 | 3300031897 | Soil | VSAAGSKSVRLLLAEDNPLVRDLLTKALEPFCEVLLAQDGADA |
| Ga0310912_101931513 | 3300031941 | Soil | MSAASGKTVKLLLAEDNPMVRELVAKGLEPFCEVASANDGA |
| Ga0310913_104627921 | 3300031945 | Soil | MSAAAGKSVKLLLADDNPLIRDLVSKSLEPFCEVVIATDGGDALL |
| Ga0310913_105795463 | 3300031945 | Soil | MTAAAAKTVKLLLAEDNPMVRDLVTRGLEPFCEVVIAADGADALL |
| Ga0318530_104813042 | 3300031959 | Soil | MTTSSAKSVRLLLAEDNPLVRDLIVKGLDPFCVVE |
| Ga0318563_106527101 | 3300032009 | Soil | MSAAGGKSVRLLVAEDNPMVRDLVSKGLEPFCEVLVANDGA |
| Ga0318558_106574521 | 3300032044 | Soil | MSAAATKTVKLLLAEDNPMVRDLVTRGLEAFCEVIVAADGADA |
| Ga0307471_1030447602 | 3300032180 | Hardwood Forest Soil | MSAAGGKSVKLLLAEDNPLVRELIVKGLEPFCEIETSADG |
| Ga0335083_115254142 | 3300032954 | Soil | MSAATSKSVKLLVAEDNPMVRDLVIRGLEPFCEVAVASDG |
| Ga0335076_100498941 | 3300032955 | Soil | MSAASNKSVKLLVAEDNPMVRNLVAKGLEPFCEVMIAA |
| Ga0335077_101241354 | 3300033158 | Soil | MTSASAKTVKMLLADDNPLVRDLIVKGMEPYCEIETASDG |
| Ga0371487_0061233_1995_2132 | 3300033982 | Peat Soil | MTAAPVKTVKLLLAEDNPLIRALVSKALDPYCEVMIAADGADALLR |
| ⦗Top⦘ |