| Basic Information | |
|---|---|
| Family ID | F091581 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 94.39 % |
| % of genes from short scaffolds (< 2000 bps) | 83.18 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.159 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.234 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.617 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (76.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 19.63 |
| PF16473 | Rv2179c-like | 15.89 |
| PF13394 | Fer4_14 | 1.87 |
| PF13353 | Fer4_12 | 0.93 |
| PF08722 | Tn7_TnsA-like_N | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.16 % |
| All Organisms | root | All Organisms | 30.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10119524 | Not Available | 827 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10131554 | Not Available | 1137 | Open in IMG/M |
| 3300000864|OpTDRAFT_1025287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300001851|RCM31_10169716 | Not Available | 532 | Open in IMG/M |
| 3300002141|M3t6BS1_1187965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300002408|B570J29032_108936808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300002408|B570J29032_109037676 | Not Available | 574 | Open in IMG/M |
| 3300002408|B570J29032_109067058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300002408|B570J29032_109506387 | Not Available | 820 | Open in IMG/M |
| 3300002835|B570J40625_100335463 | Not Available | 1507 | Open in IMG/M |
| 3300002835|B570J40625_100406658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
| 3300003277|JGI25908J49247_10126386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300003388|JGI25910J50241_10017204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2557 | Open in IMG/M |
| 3300003388|JGI25910J50241_10040390 | Not Available | 1514 | Open in IMG/M |
| 3300003393|JGI25909J50240_1007473 | Not Available | 2712 | Open in IMG/M |
| 3300003411|JGI25911J50253_10010087 | Not Available | 3582 | Open in IMG/M |
| 3300004123|Ga0066181_10203707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300004793|Ga0007760_11033357 | Not Available | 527 | Open in IMG/M |
| 3300005517|Ga0070374_10127044 | Not Available | 1326 | Open in IMG/M |
| 3300005525|Ga0068877_10350349 | Not Available | 843 | Open in IMG/M |
| 3300005582|Ga0049080_10185620 | Not Available | 690 | Open in IMG/M |
| 3300006805|Ga0075464_11048237 | Not Available | 513 | Open in IMG/M |
| 3300007722|Ga0105051_10322302 | Not Available | 1162 | Open in IMG/M |
| 3300008107|Ga0114340_1003795 | Not Available | 8345 | Open in IMG/M |
| 3300008110|Ga0114343_1192718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300008113|Ga0114346_1143653 | Not Available | 1029 | Open in IMG/M |
| 3300008448|Ga0114876_1241949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300009077|Ga0115552_1396800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300009152|Ga0114980_10342489 | Not Available | 863 | Open in IMG/M |
| 3300009154|Ga0114963_10122143 | Not Available | 1570 | Open in IMG/M |
| 3300009158|Ga0114977_10435889 | Not Available | 725 | Open in IMG/M |
| 3300009159|Ga0114978_10183023 | Not Available | 1333 | Open in IMG/M |
| 3300009159|Ga0114978_10477767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300009159|Ga0114978_10524111 | Not Available | 693 | Open in IMG/M |
| 3300009163|Ga0114970_10067361 | Not Available | 2272 | Open in IMG/M |
| 3300009164|Ga0114975_10506394 | Not Available | 650 | Open in IMG/M |
| 3300009437|Ga0115556_1152339 | Not Available | 852 | Open in IMG/M |
| 3300009443|Ga0115557_1199277 | Not Available | 785 | Open in IMG/M |
| 3300010157|Ga0114964_10261404 | Not Available | 823 | Open in IMG/M |
| 3300010157|Ga0114964_10625185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300010160|Ga0114967_10176935 | Not Available | 1165 | Open in IMG/M |
| 3300010340|Ga0116250_10549213 | Not Available | 648 | Open in IMG/M |
| 3300010356|Ga0116237_11286019 | Not Available | 605 | Open in IMG/M |
| 3300010885|Ga0133913_10298977 | Not Available | 4266 | Open in IMG/M |
| 3300010885|Ga0133913_11243130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1907 | Open in IMG/M |
| 3300013005|Ga0164292_10486617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300013014|Ga0164295_10414893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300013014|Ga0164295_10782589 | Not Available | 738 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10563953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300013372|Ga0177922_10719208 | Not Available | 549 | Open in IMG/M |
| 3300013372|Ga0177922_10750442 | Not Available | 599 | Open in IMG/M |
| 3300017722|Ga0181347_1180333 | Not Available | 563 | Open in IMG/M |
| 3300017723|Ga0181362_1031300 | Not Available | 1132 | Open in IMG/M |
| 3300017778|Ga0181349_1096371 | Not Available | 1111 | Open in IMG/M |
| 3300017780|Ga0181346_1007727 | Not Available | 4641 | Open in IMG/M |
| 3300017784|Ga0181348_1057447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1581 | Open in IMG/M |
| 3300017784|Ga0181348_1076388 | Not Available | 1334 | Open in IMG/M |
| 3300017785|Ga0181355_1095407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
| 3300018682|Ga0188851_1037273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300019784|Ga0181359_1023864 | Not Available | 2331 | Open in IMG/M |
| 3300019784|Ga0181359_1028433 | Not Available | 2152 | Open in IMG/M |
| 3300020048|Ga0207193_1076851 | Not Available | 3213 | Open in IMG/M |
| 3300020160|Ga0211733_10376925 | Not Available | 513 | Open in IMG/M |
| 3300020161|Ga0211726_10516370 | Not Available | 1029 | Open in IMG/M |
| 3300020161|Ga0211726_10985042 | Not Available | 842 | Open in IMG/M |
| 3300020162|Ga0211735_10359633 | Not Available | 720 | Open in IMG/M |
| 3300020162|Ga0211735_10783920 | Not Available | 740 | Open in IMG/M |
| 3300020172|Ga0211729_10712318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300020172|Ga0211729_10974629 | Not Available | 1228 | Open in IMG/M |
| 3300020205|Ga0211731_10802500 | Not Available | 714 | Open in IMG/M |
| 3300021519|Ga0194048_10282085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300021956|Ga0213922_1110146 | Not Available | 549 | Open in IMG/M |
| 3300021962|Ga0222713_10723561 | Not Available | 565 | Open in IMG/M |
| 3300022164|Ga0212022_1054887 | Not Available | 615 | Open in IMG/M |
| 3300022190|Ga0181354_1147852 | Not Available | 737 | Open in IMG/M |
| 3300022190|Ga0181354_1194387 | Not Available | 608 | Open in IMG/M |
| 3300022407|Ga0181351_1025165 | Not Available | 2527 | Open in IMG/M |
| 3300022555|Ga0212088_10833290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300023184|Ga0214919_10528755 | Not Available | 717 | Open in IMG/M |
| 3300025091|Ga0209616_1028625 | Not Available | 566 | Open in IMG/M |
| 3300027285|Ga0255131_1037648 | Not Available | 877 | Open in IMG/M |
| 3300027295|Ga0255126_1093654 | Not Available | 536 | Open in IMG/M |
| 3300027679|Ga0209769_1019105 | Not Available | 2429 | Open in IMG/M |
| 3300027707|Ga0209443_1182140 | Not Available | 748 | Open in IMG/M |
| 3300027707|Ga0209443_1290148 | Not Available | 546 | Open in IMG/M |
| 3300027708|Ga0209188_1064121 | All Organisms → Viruses → Predicted Viral | 1578 | Open in IMG/M |
| 3300027708|Ga0209188_1148999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300027736|Ga0209190_1040275 | Not Available | 2433 | Open in IMG/M |
| 3300027741|Ga0209085_1059718 | Not Available | 1747 | Open in IMG/M |
| 3300027782|Ga0209500_10440810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300027798|Ga0209353_10006903 | Not Available | 5671 | Open in IMG/M |
| 3300027892|Ga0209550_10275645 | Not Available | 1097 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1035505 | Not Available | 3005 | Open in IMG/M |
| 3300031784|Ga0315899_11387169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300031884|Ga0316220_1108657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
| 3300031963|Ga0315901_10308436 | Not Available | 1308 | Open in IMG/M |
| 3300032116|Ga0315903_10503989 | Not Available | 955 | Open in IMG/M |
| 3300032116|Ga0315903_10555498 | Not Available | 893 | Open in IMG/M |
| 3300034061|Ga0334987_0042397 | Not Available | 3854 | Open in IMG/M |
| 3300034066|Ga0335019_0729620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300034071|Ga0335028_0714596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300034093|Ga0335012_0264225 | Not Available | 887 | Open in IMG/M |
| 3300034102|Ga0335029_0004463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11110 | Open in IMG/M |
| 3300034116|Ga0335068_0109784 | Not Available | 1536 | Open in IMG/M |
| 3300034200|Ga0335065_0855045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300034283|Ga0335007_0087665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2329 | Open in IMG/M |
| 3300034284|Ga0335013_0353554 | Not Available | 918 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.74% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.87% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.87% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.87% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.93% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.93% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.93% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000864 | Marine plume microbial communities from the Columbia River - Metatranscriptome 25 PSU | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002141 | M3t6BS1 (103f) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101195242 | 3300000115 | Marine | SFTVKSNSIIGFSTVESQQRTVRKPAEVIKAMSAAGKPAARKIYKDLTTTETVFNGRGTENLIILKSW* |
| TBL_comb47_HYPODRAFT_101315541 | 3300000553 | Freshwater | QLKGIGAVGKPAARKFYKDIRATEVAFNGRGTENLVILRVW* |
| OpTDRAFT_10252872 | 3300000864 | Freshwater And Marine | GAGKPAARKAFKDIKATETAWNARGTENLIILKSW* |
| RCM31_101697163 | 3300001851 | Marine Plankton | IKALSAAGKPAARKIFKDLTTTETAWNARGTENLVILRSW* |
| M3t6BS1_11879652 | 3300002141 | Marine | QQRTVRKPAEIIKAMSAAGKPAARKIYKDLTTTETVFNGRGTENLIILKAW* |
| B570J29032_1089368081 | 3300002408 | Freshwater | QAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW* |
| B570J29032_1090376761 | 3300002408 | Freshwater | KAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW* |
| B570J29032_1090670581 | 3300002408 | Freshwater | ADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVVLKAW* |
| B570J29032_1095063871 | 3300002408 | Freshwater | AEIIKAMQTAGKPAARKIYKELTTTETPWNARGTENLIVLKAW* |
| B570J40625_1003354631 | 3300002835 | Freshwater | VETQQKTVRKPAETIKAITAAGKPAARKIFKELTTTETPWNGRGTENLVVLKAW* |
| B570J40625_1004066581 | 3300002835 | Freshwater | DVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW* |
| JGI25908J49247_101263862 | 3300003277 | Freshwater Lake | QKTVRKPADIVRAMQAAGKPAARKIYKDLTTTETQFNGRGTENLVILKAW* |
| JGI25910J50241_100172044 | 3300003388 | Freshwater Lake | KTVRKPADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW* |
| JGI25910J50241_100403903 | 3300003388 | Freshwater Lake | KPADVLKALSAAGKPAAXKIYKDLTTTETPFNGRGTENLVILKSW* |
| JGI25909J50240_10074731 | 3300003393 | Freshwater Lake | KPADVLKALSAAGKPAARKIYKDLTTTETPFNGRGTENLVILKSW* |
| JGI25911J50253_100100871 | 3300003411 | Freshwater Lake | QKTVRKPADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW* |
| Ga0066181_102037072 | 3300004123 | Freshwater Lake | LQKTVRKPADVLKALGAAGKPAARKIYKDLTTTETAFNGRGTENLIILKSW* |
| Ga0007760_110333572 | 3300004793 | Freshwater Lake | RKPADVLKLMSAAGKPAARRIYKDLTTTETAFNGRGTENLIILKSW* |
| Ga0070374_101270441 | 3300005517 | Freshwater Lake | ALSAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW* |
| Ga0068877_103503491 | 3300005525 | Freshwater Lake | VESQQKTVRKPADVLKAMGAAGKPAARKIYKDLTTTETPFNRRGTENLIILKSW* |
| Ga0049080_101856201 | 3300005582 | Freshwater Lentic | AEVVKAMQAAGKPAARKIYKDLTTTETGFNGRGTENLMVLKAW* |
| Ga0075464_110482372 | 3300006805 | Aqueous | VRKPADVVKAIQAAGKPAARKIYKDLTTTETPWNARGTENLIVLKAW* |
| Ga0105051_103223023 | 3300007722 | Freshwater | LTAGKPAARKIYKDLTTTETQFNGRGTENLVILKAW* |
| Ga0114340_10037951 | 3300008107 | Freshwater, Plankton | VGAGKPAARKAFKDINTTETAWNARGTENLIILKSW* |
| Ga0114343_11927182 | 3300008110 | Freshwater, Plankton | AGRPAARKAFKDIKATETAWNARGTENLIILKSW* |
| Ga0114346_11436531 | 3300008113 | Freshwater, Plankton | KGILGAGKPAARKAFKDIKATETAWNARGTENLIILKSW* |
| Ga0114876_12419492 | 3300008448 | Freshwater Lake | GIVGAGKPAARKAFKDIKATETAWNARGTENLIILKSW* |
| Ga0115552_13968001 | 3300009077 | Pelagic Marine | TVKSNSIIGFSTVESQQRTVRKPAEVIKAMSAAGKPAARKIYKDLTTTETVFNGRGTDNLIILKSW* |
| Ga0114980_103424891 | 3300009152 | Freshwater Lake | DILKAMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW* |
| Ga0114963_101221433 | 3300009154 | Freshwater Lake | FTIKNNSVIGYSTVETLQKTVRRPADVVKAIQAAGKPAARKIYKDLTTTETPWNARGTENLIVLKAW* |
| Ga0114977_104358891 | 3300009158 | Freshwater Lake | ITKAIQAAGKPAARKIYKELTTTETPWNTRGTENLIILKAW* |
| Ga0114978_101830231 | 3300009159 | Freshwater Lake | ADVVKAVQAAGKPAARKIYKDLTTTETPWNARGTENLIILKSW* |
| Ga0114978_104777671 | 3300009159 | Freshwater Lake | KTVRKPAETLKAMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW* |
| Ga0114978_105241111 | 3300009159 | Freshwater Lake | AVGKPAARKAFEAIKGTEVKWNGRGNENLVILKAW* |
| Ga0114970_100673611 | 3300009163 | Freshwater Lake | DVVKAIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW* |
| Ga0114975_105063941 | 3300009164 | Freshwater Lake | KTVRKPADITKAIQAAGKPAARKIYKELTTTETPWNTRGTENLIILKAW* |
| Ga0115556_11523391 | 3300009437 | Pelagic Marine | STVESQQRTVRKPAEVIKAMSAAGKPAARKIYKDLTTTETVFNGRGTENLIILKSW* |
| Ga0115557_11992772 | 3300009443 | Pelagic Marine | TVKSNSIIGFSTVESQQRTVRKPAEVIKAMSAAGKPAARKIYKDLTTTETVFNGRGTENLIILKSW* |
| Ga0114964_102614042 | 3300010157 | Freshwater Lake | GAVGKPAARKFYKDIRATEVAFNGRGTENLVILRVW* |
| Ga0114964_106251851 | 3300010157 | Freshwater Lake | RKPTDIVRAMQAAGKPAARKIYKDLTTTETQFNGRGTENLVILKAW* |
| Ga0114967_101769352 | 3300010160 | Freshwater Lake | VVKAIQAAGKPAARKLFKEIKATETAWNGRGTENLIILKSW* |
| Ga0116250_105492131 | 3300010340 | Anaerobic Digestor Sludge | AGKPAARKIYKDLTTTETPFNGRGTENLIILKSW* |
| Ga0116237_112860192 | 3300010356 | Anaerobic Digestor Sludge | KTVRKPAETIKAMQAAGKPAARKLFKDIRTTETAFNGRGTENLVILKSW* |
| Ga0133913_102989771 | 3300010885 | Freshwater Lake | LQKTVRKPADVVKSIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW* |
| Ga0133913_112431303 | 3300010885 | Freshwater Lake | QKTVRKPADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLMVLKAW* |
| Ga0164292_104866172 | 3300013005 | Freshwater | LAAGLPAACMQKTVRKPAEVVKAMQAAGKPAARKIYKDLTTTETGFNGRGTENLMVLKTW |
| Ga0164295_104148932 | 3300013014 | Freshwater | ETLQKTVRKPADVIKAIQAAGKPAARKIYRDLTTTETPWNARGTENLLVLKAW* |
| Ga0164295_107825891 | 3300013014 | Freshwater | QLKAVIGVGKPAARKAFAAINATETKWNGRGNDNLIILWAW* |
| (restricted) Ga0172365_105639531 | 3300013127 | Sediment | ADTLQKTVRKPADTVKAIAAAGKPAARKIFADLSTTETQFNCRGTEHLVVLKAW* |
| Ga0177922_107192081 | 3300013372 | Freshwater | YSTVETLQKTVRKPADVIRAIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW* |
| Ga0177922_107504421 | 3300013372 | Freshwater | IQAAGKPAARKLFKEIKATETAWNGRGTENLIILKSW* |
| Ga0181347_11803331 | 3300017722 | Freshwater Lake | RKPADVVKAIQAAGKPAARKLFKEIKATETAWNGRGTENLIILKSW |
| Ga0181362_10313001 | 3300017723 | Freshwater Lake | STVETLQKTVRKPADVIRAIQAAGKPAARKIYKDLTTTETSWNARGTENLLVLKAW |
| Ga0181349_10963711 | 3300017778 | Freshwater Lake | AEILKAMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0181346_10077271 | 3300017780 | Freshwater Lake | KGIIGAGKPAARKAFKDINTTETAWNARGTENLIILKSW |
| Ga0181348_10574471 | 3300017784 | Freshwater Lake | DVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLMVLKAW |
| Ga0181348_10763881 | 3300017784 | Freshwater Lake | TLRKPGDVVKAIQAAGKPAARKLFKEIKATETAWNGRGTENLIILKSS |
| Ga0181355_10954071 | 3300017785 | Freshwater Lake | QKTVRKPADVVRAVQAAGKPAARKIYKDLTTTETAFNGRGTENLMVLKAW |
| Ga0188851_10372731 | 3300018682 | Freshwater Lake | VIKAMSAAGKPAARKIYKDLTTTETVFNGRGTENLIILKSW |
| Ga0181359_10238641 | 3300019784 | Freshwater Lake | EAMQAAGKPAARKIYKDLTTTETGFNGRGTENLVILKSW |
| Ga0181359_10284334 | 3300019784 | Freshwater Lake | VLKLMSAAGKPAARRIYKDLTTTETAFNGRGTENLIILKSW |
| Ga0207193_10768514 | 3300020048 | Freshwater Lake Sediment | XALQAAGKPAARKLFKDIKTTETAFNGRGTENLVILKSW |
| Ga0211733_103769251 | 3300020160 | Freshwater | PADVLRALGAAGKPAARKIYKDLTTTETAFNGRGTENLMILKSW |
| Ga0211726_105163701 | 3300020161 | Freshwater | KAIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW |
| Ga0211726_109850421 | 3300020161 | Freshwater | AMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0211735_103596332 | 3300020162 | Freshwater | LRALGAAGKPAARKIYKDLTTTETAFNGRGTENLIILKSW |
| Ga0211735_107839202 | 3300020162 | Freshwater | IVGAGKPAARKAFKDIKATETAWNARGTENLIILKSW |
| Ga0211729_107123181 | 3300020172 | Freshwater | QDVIKAVQAAGKPAARKIFKELTTTETAWNARGTENLIILKSW |
| Ga0211729_109746293 | 3300020172 | Freshwater | QAAGKPAARKLFKEIKATETAWNGRGTENLIILKSW |
| Ga0211731_108025002 | 3300020205 | Freshwater | GAAGKPAARKIYKDLTTTETAFNGRGTENLIILKSW |
| Ga0194048_102820852 | 3300021519 | Anoxic Zone Freshwater | VQAAGKPAARKIYKDLTTTETPFNGRGTENLMILKAW |
| Ga0213922_11101462 | 3300021956 | Freshwater | AAGKPAARKIYKDLTTTETPWNARGTENLIILKAW |
| Ga0222713_107235612 | 3300021962 | Estuarine Water | AEILKAMSAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0212022_10548871 | 3300022164 | Aqueous | GQQRTVRKPAEVIKAMSAAGKPAARKIYKDLTTTETVFNGRGTENLIILKSW |
| Ga0181354_11478521 | 3300022190 | Freshwater Lake | STVETLQKTVRKPADVVKAIQAAGKPAARKIYKELTTTETPWNARGTENLIVLKAW |
| Ga0181354_11943872 | 3300022190 | Freshwater Lake | VRKPADVIRAIQAAGKPAARKIYRDLTTTETPWNARGTENLIVLKAW |
| Ga0181351_10251651 | 3300022407 | Freshwater Lake | TMQAAGKPAARKIYKDLTTTETQFNGRGTENLVILKAW |
| Ga0212088_108332901 | 3300022555 | Freshwater Lake Hypolimnion | IGAVGKPAARKFYKDIRATEVAFNGRGTENLIILRVW |
| Ga0214919_105287552 | 3300023184 | Freshwater | ADVVRAVQAAGKPAARKLFKDIKATETVWNGRGTENLIILKSW |
| Ga0209616_10286252 | 3300025091 | Freshwater | TLQKTVRKPADVVKAIQAAGKPAARKIYKELTTTETPWNARGTENLIILKAW |
| Ga0255131_10376481 | 3300027285 | Freshwater | RKPAEVLKALGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0255126_10936541 | 3300027295 | Freshwater | LKAMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0209769_10191054 | 3300027679 | Freshwater Lake | PADVVKAVQAAGKPAARKIYKDLSTTETPFNGRGTENLVILKAW |
| Ga0209443_11821402 | 3300027707 | Freshwater Lake | QAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW |
| Ga0209443_12901482 | 3300027707 | Freshwater Lake | PADVTKAIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW |
| Ga0209188_10641213 | 3300027708 | Freshwater Lake | SIIGFSTVDSLQRTVRKPADIVKSVQTAGKPAARKIYKDLTTTETAFNGRGTENLVILKS |
| Ga0209188_11489991 | 3300027708 | Freshwater Lake | VVRAIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW |
| Ga0209190_10402751 | 3300027736 | Freshwater Lake | QKTVRKPADVVRAIQAAGKPAARKIYKDLTTTETPWNARGTENLIILKAW |
| Ga0209085_10597181 | 3300027741 | Freshwater Lake | ETLQKTVRRPADVVKAIQAAGKPAARKIYKDLTTTETPWNARGTENLIVLKAW |
| Ga0209500_104408102 | 3300027782 | Freshwater Lake | KTVRKPAETLKAMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0209353_100069037 | 3300027798 | Freshwater Lake | MQAAGKPAARKIYKDLTTTETQFNGRGTENLVVLKAW |
| Ga0209550_102756451 | 3300027892 | Freshwater Lake | AMQAAGKPAARKIYKDLTTTETGFNGRGTENLVILKSW |
| (restricted) Ga0247834_10355051 | 3300027977 | Freshwater | ADVVKAVQAAGKPAARKIYKDLSTTETPFNGRGTENLVVLKAW |
| Ga0315899_113871692 | 3300031784 | Freshwater | STVESQQKTVRKPAEVLKALGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0316220_11086572 | 3300031884 | Freshwater | AEQLKGIGAVGKPAARKFYKDIRATEVAFNGRGTENLVILRVW |
| Ga0315901_103084363 | 3300031963 | Freshwater | RKPAEVVKAMQAAGKPAARKIYKDLTTTETGFNGRGTENLMVLKAW |
| Ga0315903_105039892 | 3300032116 | Freshwater | RAMQAAGKPAARKIYKELTTTETPWNARGTENLIILKAW |
| Ga0315903_105554982 | 3300032116 | Freshwater | ILKLMGAAGKPAARKIYKDLTTTETPFNGRGTENLIILKSW |
| Ga0334987_0042397_3720_3854 | 3300034061 | Freshwater | PADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVVLKAW |
| Ga0335019_0729620_413_565 | 3300034066 | Freshwater | QKTVRKPADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW |
| Ga0335028_0714596_12_167 | 3300034071 | Freshwater | MQKTVRKPADVVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVVLKAW |
| Ga0335012_0264225_70_183 | 3300034093 | Freshwater | MQAAGKPAARKIYKDLNTTETQFNGRGTENLVVLKAW |
| Ga0335029_0004463_2_109 | 3300034102 | Freshwater | GAGKPAARKAFKDIKATETAWNARGTENLIILKSW |
| Ga0335068_0109784_51_164 | 3300034116 | Freshwater | MSAAGKPAARKIYKDLTTAETVFNGRGTENLIILKAW |
| Ga0335065_0855045_37_192 | 3300034200 | Freshwater | MQKTVRKPADIVRAMQAAGKPAARKIYKDLTTTETQFNGRGTENLVILKAW |
| Ga0335007_0087665_2_127 | 3300034283 | Freshwater | VVKAVQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW |
| Ga0335013_0353554_1_114 | 3300034284 | Freshwater | VQAAGKPAARKIYKDLTTTETPFNGRGTENLVILKAW |
| ⦗Top⦘ |