NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091555

Metagenome / Metatranscriptome Family F091555

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091555
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 102 residues
Representative Sequence MSENQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL
Number of Associated Samples 95
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.37 %
% of genes near scaffold ends (potentially truncated) 26.17 %
% of genes from short scaffolds (< 2000 bps) 83.18 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.393 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(28.972 % of family members)
Environment Ontology (ENVO) Unclassified
(39.252 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(46.729 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.24%    β-sheet: 0.00%    Coil/Unstructured: 50.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF08281Sigma70_r4_2 48.60
PF13801Metal_resist 38.32
PF16576HlyD_D23 2.80
PF09084NMT1 0.93
PF02738MoCoBD_1 0.93
PF00083Sugar_tr 0.93
PF01315Ald_Xan_dh_C 0.93
PF00005ABC_tran 0.93
PF00529CusB_dom_1 0.93
PF12838Fer4_7 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.39 %
UnclassifiedrootN/A5.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11734324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium701Open in IMG/M
3300000956|JGI10216J12902_100510347All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1362Open in IMG/M
3300000956|JGI10216J12902_102931977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2249Open in IMG/M
3300003994|Ga0055435_10162689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300005336|Ga0070680_100640953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium913Open in IMG/M
3300005354|Ga0070675_101346516All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300005356|Ga0070674_101309432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300005441|Ga0070700_101116314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium654Open in IMG/M
3300005830|Ga0074473_10531140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1051Open in IMG/M
3300006844|Ga0075428_100601053Not Available1175Open in IMG/M
3300006845|Ga0075421_100258631All Organisms → cellular organisms → Bacteria → Proteobacteria2132Open in IMG/M
3300006845|Ga0075421_101390897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300006845|Ga0075421_102277396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300006853|Ga0075420_100533017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1014Open in IMG/M
3300009053|Ga0105095_10236486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1002Open in IMG/M
3300009053|Ga0105095_10265387All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium942Open in IMG/M
3300009078|Ga0105106_10063655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2718Open in IMG/M
3300009087|Ga0105107_10573105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium786Open in IMG/M
3300009100|Ga0075418_11073132All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300009153|Ga0105094_10129641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1432Open in IMG/M
3300009162|Ga0075423_10290507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1713Open in IMG/M
3300009166|Ga0105100_10333008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium913Open in IMG/M
3300009167|Ga0113563_11369250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium830Open in IMG/M
3300009171|Ga0105101_10573602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300009609|Ga0105347_1033516All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1799Open in IMG/M
3300010403|Ga0134123_10424671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1227Open in IMG/M
3300011395|Ga0137315_1057312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300011413|Ga0137333_1080625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium749Open in IMG/M
3300011417|Ga0137326_1014606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1714Open in IMG/M
3300011419|Ga0137446_1073969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium788Open in IMG/M
3300011429|Ga0137455_1176740All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300011429|Ga0137455_1238474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300011430|Ga0137423_1062702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1104Open in IMG/M
3300011432|Ga0137428_1054884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1061Open in IMG/M
3300011433|Ga0137443_1117385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300011434|Ga0137464_1006446All Organisms → cellular organisms → Bacteria3039Open in IMG/M
3300011435|Ga0137426_1037503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1238Open in IMG/M
3300011436|Ga0137458_1045019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1171Open in IMG/M
3300011437|Ga0137429_1065474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1075Open in IMG/M
3300011441|Ga0137452_1051600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1306Open in IMG/M
3300012034|Ga0137453_1040134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300012039|Ga0137421_1158351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300012039|Ga0137421_1242381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300012143|Ga0137354_1026468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium891Open in IMG/M
3300012171|Ga0137342_1132077All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300012225|Ga0137434_1073259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300012226|Ga0137447_1126082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300012228|Ga0137459_1035076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1417Open in IMG/M
3300012668|Ga0157216_10504028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300012912|Ga0157306_10488851Not Available503Open in IMG/M
3300013308|Ga0157375_12498982Not Available617Open in IMG/M
3300014272|Ga0075327_1229639All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300014874|Ga0180084_1053373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium805Open in IMG/M
3300014875|Ga0180083_1088220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300014880|Ga0180082_1139670Not Available559Open in IMG/M
3300014885|Ga0180063_1034569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1419Open in IMG/M
3300015257|Ga0180067_1161061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300015258|Ga0180093_1058842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300017997|Ga0184610_1268047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300018031|Ga0184634_10414282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300018053|Ga0184626_10229966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium781Open in IMG/M
3300018054|Ga0184621_10124168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium924Open in IMG/M
3300018056|Ga0184623_10030561All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2424Open in IMG/M
3300018063|Ga0184637_10501241All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium705Open in IMG/M
3300018071|Ga0184618_10074844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1284Open in IMG/M
3300018077|Ga0184633_10015134All Organisms → cellular organisms → Bacteria → Proteobacteria3744Open in IMG/M
3300018077|Ga0184633_10083638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1643Open in IMG/M
3300018078|Ga0184612_10035124All Organisms → cellular organisms → Bacteria → Proteobacteria2599Open in IMG/M
3300018083|Ga0184628_10003211All Organisms → cellular organisms → Bacteria → Proteobacteria7797Open in IMG/M
3300018084|Ga0184629_10117316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1321Open in IMG/M
3300018422|Ga0190265_10021012All Organisms → cellular organisms → Bacteria → Proteobacteria5210Open in IMG/M
3300018422|Ga0190265_10169569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2159Open in IMG/M
3300018422|Ga0190265_10315440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1639Open in IMG/M
3300018429|Ga0190272_13022287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300018432|Ga0190275_10003195All Organisms → cellular organisms → Bacteria → Proteobacteria11647Open in IMG/M
3300018466|Ga0190268_10467434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium842Open in IMG/M
3300018469|Ga0190270_10001064All Organisms → cellular organisms → Bacteria → Proteobacteria12564Open in IMG/M
3300018469|Ga0190270_10070332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2542Open in IMG/M
3300018476|Ga0190274_10540342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1177Open in IMG/M
3300018481|Ga0190271_10360889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1537Open in IMG/M
3300018481|Ga0190271_10755438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1096Open in IMG/M
3300018920|Ga0190273_10842372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300019377|Ga0190264_11550020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300020060|Ga0193717_1080202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1070Open in IMG/M
3300020186|Ga0163153_10042984All Organisms → cellular organisms → Bacteria → Proteobacteria3184Open in IMG/M
3300021051|Ga0206224_1004206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1484Open in IMG/M
3300021051|Ga0206224_1007004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1203Open in IMG/M
3300021063|Ga0206227_1104706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300021082|Ga0210380_10143367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1070Open in IMG/M
3300021090|Ga0210377_10043083All Organisms → cellular organisms → Bacteria → Proteobacteria3158Open in IMG/M
3300021859|Ga0210334_10483281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300022226|Ga0224512_10613275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300025917|Ga0207660_11220398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300025961|Ga0207712_10431835All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300027513|Ga0208685_1011348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2149Open in IMG/M
3300027533|Ga0208185_1044707Not Available1073Open in IMG/M
3300027815|Ga0209726_10211076Not Available1014Open in IMG/M
3300027818|Ga0209706_10296006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium767Open in IMG/M
3300027909|Ga0209382_10597350All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1202Open in IMG/M
3300031965|Ga0326597_10100811All Organisms → cellular organisms → Bacteria → Proteobacteria3517Open in IMG/M
3300032144|Ga0315910_11115488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300033419|Ga0316601_102657399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300033485|Ga0316626_11826531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300034115|Ga0364945_0097132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium860Open in IMG/M
3300034178|Ga0364934_0016887All Organisms → cellular organisms → Bacteria2619Open in IMG/M
3300034354|Ga0364943_0230738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium687Open in IMG/M
3300034417|Ga0364941_166169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil28.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment11.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment7.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.48%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.80%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment2.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.93%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.93%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.93%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.93%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011395Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022226Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1173432423300000891SoilMSEYQDEKLDRMLHSRRIEPASQNLAARIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALILGMMLGFSTAPDDDQSG
JGI10216J12902_10051034713300000956SoilMSENQDEKLDQMLRSRRIEPAHRDLAARIILKAQTMPQVQNVSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGSVAAQSYIASDEELL*
JGI10216J12902_10293197733300000956SoilMSEYQDEKLESMLRSRRTGTVAPDLAGRIILQAKSLPQLQNLSLWQGVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENSPLSDASNAIVQSYIGGDEELL*
Ga0055435_1016268913300003994Natural And Restored WetlandsMSEYQDEKLESMLRSRRTQMVTPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSVTAQSYIAGDEELL*
Ga0070680_10064095313300005336Corn RhizosphereMSEDQDEKLDRMLHSRRIEPASQDLAARIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALILGMMLGFSTAPDNDQSGDPSSMSAQSYIAGDEELL*
Ga0070675_10134651623300005354Miscanthus RhizosphereMSQDQDEKLDKMLHSRRIEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL*
Ga0070674_10130943213300005356Miscanthus RhizosphereEKLDKMLHSRRIEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL*
Ga0070700_10111631413300005441Corn, Switchgrass And Miscanthus RhizosphereMNQDQDEKLDRMLHSRRIEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL*
Ga0074473_1053114013300005830Sediment (Intertidal)MSEKQDEKLESMLRSRRTETVNPDLAGRIILQAQSLPQSQNVSLWQAVRQLFAEFHLPKPGYVLAGALVLGMVLGFSTAPENGQLSDASSATAQS
Ga0075428_10060105313300006844Populus RhizosphereMSEIQDEKLERMLHSRRVEPASQDLAARIILKAQSLPQVQNISLWQGVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPGNAQMSDAGSVTAQ
Ga0075421_10025863133300006845Populus RhizosphereMSENQDEKLDQMLRSRRIEPAHRDLAARIILKAQTVPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGSVTAQSYIASDEELL*
Ga0075421_10139089723300006845Populus RhizosphereMSENRDEKLDRMLHSRRIEPASQDLAARIILKAQSLPQVQNMSLWQALRQLFAEFHLPQPGYVLATALVLGMMLGFGTAPDNDLSSDASSVTAQISIAGDEELL*
Ga0075421_10227739623300006845Populus RhizosphereMSEIQDEKLDRMLHSRRVEPASQDLAARIILKAQSLPQVQNISLWQGVRQLFAEFHLPQPGYVLATALVLGMMLGFGTAPENDLSSDASSVTAQISIAGDEELL*
Ga0075420_10053301723300006853Populus RhizosphereMSENQDEKLDQMLRSRRIEPAHRDLAARIILKAQTMPQGQNVSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGSVTAQSYIASDEELL*
Ga0105095_1023648623300009053Freshwater SedimentMSENQDEKLESMLRSRRTETVTPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSVTAQSYIAGDEELL*
Ga0105095_1026538713300009053Freshwater SedimentEPTSPDLAERIILRAQSLPQAQNISLWNAVRQLFVEFHLPKPGYVLATALVLGMVLGFSTVPDNGQNGDAGTATAQSYIVGDEGLL*
Ga0105106_1006365523300009078Freshwater SedimentMSQNHDEKLDAMLRQRRVEPTSLDLAERIILRAQSLPQAQNISLWNAVRQLFVEFHLPKPGYVLATALVLGMVLGFSTVPDNGQNGDAGTATAQSYIVGDEGLL*
Ga0105107_1057310513300009087Freshwater SedimentQDEKLDAMLRQRRVEPTSLDLAERIILRAQSLPQAQNISLWNAVRQLFVEFHLPKPGYVLATALVLGMVLGFSTVPDNGQNGDAGTATAQSYIVGDEGLL*
Ga0075418_1107313223300009100Populus RhizosphereMSENQDEKLDQMLRSRRIEPAHRDLAARIILKAQTVPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGSVAAQSYIASDEELL*
Ga0105094_1012964113300009153Freshwater SedimentMSRNQDEKLDAMLRQRRVEPTSPDLAERIILRAQSLPQAQNISLWNAVRQLFVEFHLPKPGYVLATALVLGMVLGFSTAPDNGQNGDAGTATAQSYIAGDEGLL*
Ga0075423_1029050733300009162Populus RhizosphereMSEDQDEKLDRMLHSRRIEPASQDLASRIILKAQSLPQLQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTGPDNDQSGDISSMTAQSYIAGDEELL*
Ga0105100_1033300823300009166Freshwater SedimentMSRNQDEKLDAMLRQRRVEPTSPDLAERIILRAQSLPQAQNISLWNAVRQLFVEFHLPKPGYVLATALVLGMVLGFSTVPDNGQNGDAGTATAQSYIVGDEGLL*
Ga0113563_1136925013300009167Freshwater WetlandsMSENQDEKLESMLRSRRMETVTPDLAGRIILQAQSLPQLQNVPLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSANAQSYIAGDEELL*
Ga0105101_1057360223300009171Freshwater SedimentMSENQDEKLESMLRSRRTETVTPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSD
Ga0105347_103351623300009609SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSEANTASAQSYIAGDEELL*
Ga0134123_1042467123300010403Terrestrial SoilMSQDQDEKLDKMLHSRRIEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALILGMMLGFSTGPDNDQSGDISSMTAQSYIAGDEELL*
Ga0137315_105731213300011395SoilMSENQDEKLASMLRSRRIEPASHDLAARIILKVQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALILGMMLGFSTAPENGQLSDASTASAHSYIAADEELL*
Ga0137333_108062523300011413SoilMTENEDEKLARLLHSRPLEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPEDSQLSDASSATAQSYIAGDEELL*
Ga0137326_101460633300011417SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAAENGQLSEANTASAQSYIAGDEELL*
Ga0137446_107396923300011419SoilRRIEPASHDLAARIILQAQSLPQVQNISLWHSVRQLFAELHLPQPGYVLASALILGMLLGFNTAPDHSTLNETNSQVAQSFFSDDEELL*
Ga0137455_117674013300011429SoilMSENQDEKLDKLLRSRRIEPARHDLAARIILRAQTVPQVQNVSLWQAVRQLFAEFHLPQPGYVLASALILGMLLGFSIAPDHASLNENNSQAAQSFLSGDEELL*
Ga0137455_123847413300011429SoilMTENEDEKLARLLHSRPLEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSMAPENGQLSDAGSATAQSYIAGDEELL*
Ga0137423_106270223300011430SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQLQNVPLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0137428_105488433300011432SoilESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSEANTASAQTYIAGDEELL*
Ga0137443_111738523300011433SoilMSGNKDEKLDSMLRSRRIEPARHDLAARIILRAQTVPQVQNVSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPENDQSGDASSATAQNYITSDEELL*
Ga0137464_100644613300011434SoilDEKLARLLHSRPLEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGIVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0137426_103750313300011435SoilMSENQDEKLESMLRSRRTETVTPDLAERIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0137458_104501923300011436SoilMTENEDEKLARLLHSRPIEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSMAPENGQLSDASTAAAQSYITGDEELL*
Ga0137429_106547423300011437SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0137452_105160023300011441SoilMSENQDEKLESMLRSRRMETVTPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPEDSQLSDASLATAQSYIAGDEELL*
Ga0137453_104013423300012034SoilEVFMIENEDEKLVRLLHSRRIEPASHDLVARIILKAQSLPQLESTSLWQAVRQLFAEFHLPKPGYVLASALVLGMVVGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0137421_115835123300012039SoilMLRSRRMETVTPDLAGRIILQAQSLPQLENVPLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0137421_124238113300012039SoilMSENRDEKLETMLRSRRVEPVSHDLASRIVLKAQSLPQVQNISLWNAVRQLFVEFHLPKPGYVLASALVLGMVLGFSTAPENGQSSDTNSV
Ga0137354_102646813300012143SoilMSETQDEKLESMLRSRRTETVTLDLAGRIILQAQSLPQVQNISLWQGVRQLFAEFHLPKPGYVLASALILGMVLGFSTAPENGQLSDANTASAQSYIAGDEELL*
Ga0137342_113207723300012171SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSMAPENGQLSDAGSATAQSYIAGDEELL*
Ga0137434_107325923300012225SoilASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSMAPENGQLSDAGSATAQSYIAGDEELL*
Ga0137447_112608223300012226SoilEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSMAPENGQLSDAGSATAQSYIAGDEELL*
Ga0137459_103507623300012228SoilMSENQDEKLESMLRSRRTETVTPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGIVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0157216_1050402823300012668Glacier Forefield SoilMTENEDEKLARLLHSRPIEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASTASAQSYIAGDEELL*
Ga0157306_1048885113300012912SoilEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL*
Ga0157375_1249898223300013308Miscanthus RhizosphereKIICEVFMSEEQDEKLTRMLHSRRIDPASENLAARIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL*
Ga0075327_122963923300014272Natural And Restored WetlandsMSKNQDENLDRMLRQRRAQPASPDLAGRIILKAQSLPQAENNSLWAAVRQLFVEFHLPKPAYVLAGTLVLGMALGFGTAPENGQSSDAGISTAQSYLAGDEGLL*
Ga0180084_105337323300014874SoilMSENQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL*
Ga0180083_108822013300014875SoilMTENEDEKLARLLHSRLIEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDVGSASAQSYIA
Ga0180082_113967013300014880SoilKLDQMLRSRRIEPAHRDLAARIILKAQTVPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGSVTAQSYIASDEELL*
Ga0180063_103456923300014885SoilMSENQDKKLETMLRSRRIEPVSHDLASRIILKAQSLPQAQNISLWNAVRQLFAEFHLPKPGYVLASALVLGIVLGFSTAPENNQSGDAGSATAQSYIAGDEGFL*
Ga0180067_116106113300015257SoilMSEYQDEKLESMLRSRRMETVTPDLAGRIILQAQSLPQLQNVPLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSMAPENGQLSDA
Ga0180093_105884223300015258SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDANTASAQSYIAGDEELL*
Ga0184610_126804713300017997Groundwater SedimentRSRRTEAAIPDLAARIILQAQSLPQVQNISLWQAVRQLFAEFHLPKPGYVLASVLVLWMVIGFSTAPENGQLSDASSATAHSYIAGDEGLL
Ga0184634_1041428213300018031Groundwater SedimentMSENQDEKLETMLRSRRVEPVSHDLASRIILKAQSMPQVQNISLWNAVRQLFAEFHLPKPGYVLASALILGMLLGFNIAPDHSSLNENNSQTAQSFLSGDEELL
Ga0184626_1022996613300018053Groundwater SedimentSENENEKLDKMLHSRRIEPARHDLAARIILKAQSLPQVQNVSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQISDAGSVTAQSYIASDEELL
Ga0184621_1012416823300018054Groundwater SedimentMSGNEDEKLDSMLRSRRIEPARHDLTARIILKAQTVPQVQNISLWQGVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPENDQSSDASPAIAQSYIAGDEELL
Ga0184623_1003056123300018056Groundwater SedimentMSGNEDEKLDSILRSRRIEPARHDLAARIILKAQTMPQVQNVSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPENDQNSDASSATAQNYIAGDEELL
Ga0184637_1050124123300018063Groundwater SedimentMSENEDEKLARMLHSRRIEPASHDLAARIILQAQSLPQVQNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVVGFSTAPENSQLSEASSATAHSYIGGDEGLL
Ga0184618_1007484423300018071Groundwater SedimentMSGNEDEKLDSMLRSRRIEPARHDLAARIILKAQTVPQVQNISLWQGVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPENDQSSDASPAIAQSYIAGDEELL
Ga0184633_1001513443300018077Groundwater SedimentMSDNRDDKLDSMLRSRRIEAASPDLAARIILKAQSLPQVQNISLWHSVRQLFAEFHLPKPGYVLASALVLGMVVGFSTAPENSQLSEASSATAHSYIGGDEGLL
Ga0184633_1008363833300018077Groundwater SedimentMSENEDEKLARMLHSRRIEPASHDLAARIILKAQSLPQLQNISLWQAVRQLFAEFHLPKPGYVLASALILGMLLGFNIAPDHSSLNENNSQAAQSFLSGDEELL
Ga0184612_1003512443300018078Groundwater SedimentMSGNEDEKLDSMLRSRRIEPARHDLAARIILKAQTVPQVQNISLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPENGQLSDAGSVTAQSYIASDEELL
Ga0184628_1000321163300018083Groundwater SedimentMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSEANTASAQSYIAGDEELL
Ga0184629_1011731623300018084Groundwater SedimentMSEYQDEKLESMLRSRRAETVTPDLAGRIILQAQSLPQLQNISLWHSVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSVTAQSYIAGDEELL
Ga0190265_1002101213300018422SoilMSENRDEKLETMLRSRRIEPVSHDLTSRIILKAQSLPQGQNISLWSALRQLFAEFNLPKPAYVLATALVLGMMLGFSTAPENGQSGDASSATTQSYIAGDEGLL
Ga0190265_1016956933300018422SoilMSENQDEKLEKMLRSRRVEPVSHDLASRIILKVQSLPQVQNISLWDAVRQLFAEFHLPKPGYVLASALVLGMMLGFSTAPENGQSVDPSSATGQSYLAGDEGLL
Ga0190265_1031544033300018422SoilMSEYQDEKLESLLRSRHEETMAPDLAGRIILRAKSLPQLQNISLWQGVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENSQLSDTGNMTVQSFITGDEELL
Ga0190272_1302228723300018429SoilMSENENEKLDRMLHSRRIEPASHDLAARIILKAQSLAQVQNVSLWQAVRQLFAEFHLPQPGYVLATALILGMMLGFSTAPENGQSVDPSSATGQSYLAGDEGLL
Ga0190275_10003195113300018432SoilMSEYQDEKLESLLRSRHAETVAPDLAGRIILQAKSVPQLQNISLWQGVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENSQLSDASNVTVQSFIAGDEELL
Ga0190268_1046743423300018466SoilMSEYQDEKLESMLRSRRTGTVAPDLAGRIILQAKSLPQLQNLSLWQGVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENSQLSDASNATVQSYIGGDEELL
Ga0190270_1000106483300018469SoilMSENQDEKLDQMLRSRRIEPAHRDLAARIILKAQTVPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGSVTAQSYIASDEELL
Ga0190270_1007033233300018469SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIIFQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDANTASAQSYIAGDEELL
Ga0190274_1054034223300018476SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQLQNISLWQGVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSEANTASAQSYIAGDEELL
Ga0190271_1036088933300018481SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAAENGQLSEANTASAQSYIAGDEELL
Ga0190271_1075543823300018481SoilMTENEDEKLARLLHSRPIEPASHDLAARIILKAQSLPQLQNVSLWQAVRQLFAEFHLPKPGYVLASALILGMVLGFSTAPENGQLSDASSASAQSYIAGDEELL
Ga0190273_1084237213300018920SoilMSEYQDEKLESLLRSRRAETVAPDLAGRIILQAQSLPQLQNISLWQGVRQLFAEFHLPKPGYVLASALILGMVLGFSTAPENSQLSDASNATVQSYIAGDEEL
Ga0190264_1155002023300019377SoilMSENQDEKLEKMLRSRRVEPVSHDLASRIILKVQSLPQVQNISLWDAVRQLFAEFHLPKPGYVLASALILGMMLGFSTAPENGQSGDPSSATAQSYLAGDEGLL
Ga0193717_108020233300020060SoilMSENQDEKLETMLRSRRVEPVSHDLASRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPKPGYVLASALVLGMMLGFSTAPENTQSSDASPATAQSYIAGDEGLL
Ga0163153_1004298443300020186Freshwater Microbial MatMSENQDEKLARMLHSRRIEPASHDLAERIILQAQSLPQIQNISLWQSVRQLFAEFRLPKPGYVLATALILGMLLGFNLEPEYAGQNQTNSQAAQSFLTGDEGML
Ga0206224_100420633300021051Deep Subsurface SedimentMSENEDEKLARMLHSRRIEPASQDLAARIISQAQSLPQVQNISLWQSVRQLFAEFHLPKPGYVLASALILGMVLGFSTAPENGQLSEAGSATAQSFLSGDEELL
Ga0206224_100700423300021051Deep Subsurface SedimentMSENQDEKLASMLRSRRIEPASHDLAARIILKAQSLPQLESTSLWQAVRQLFAEFHLPKPGYVLASALVLGMVVGFSTAPENGQLSDASSATAQSYIAGDEELL
Ga0206227_110470613300021063Deep Subsurface SedimentMSENQDEKLASMLRSRRIEPASHDLAARIILKAQSLPQLESTSLWQAVRQLFAEFHLPKPGYVLASALILGMVLGFSTAPENGQLSEAGSATAQSFLSGDEELL
Ga0210380_1014336723300021082Groundwater SedimentMSQDQDEKLDKMLHSRRIEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL
Ga0210377_1004308333300021090Groundwater SedimentMSENQDEKLETMLRSRRVEPASHDLASRIILKAQSLPQVQNISLWNAVRQLFAEFHLPKPGYVLASALVLGMMVGFSTAPENGQSGDASSTTAQSYLAGDEGLL
Ga0210334_1048328123300021859EstuarineFMSEKQDEKLESMLRSRRTETVNPDLAGRIILQAQSLPQSQNVSLWQAVRQLFAEFHLPKPGYVLAGALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL
Ga0224512_1061327523300022226SedimentSDNEDKKLEAMLRQRRVEPASPDLAARILLKAQSLPQMRNLSLWQFVHQLFAEFHLPKPGYVLASALVLGMLVGFSTAPKNGPISDASSSIAQSYIADDEGLL
Ga0207660_1122039823300025917Corn RhizosphereMSEDQDEKLDRMLHSRRIEPASQDLAARIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALILGMMLGFSTAPDNDQSGDPSSMSAQSYIAGDEELL
Ga0207712_1043183523300025961Switchgrass RhizosphereMNQDQDEKLDRMLHSRRIEPSSQDLATRIILKAQSLPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDDDQSGNPSSMAAQSYIAGDEELL
Ga0208685_101134823300027513SoilMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSATAQSYIAGDEELL
Ga0208185_104470733300027533SoilMSENQDEKLDQMLRSRRIEPAHRDLAARIILKAQTVPQVQNLSLWQAVRQLFAEFHLPQPGYVLATALVLGMMLGFSTAPDNAQMSDAGS
Ga0209726_1021107633300027815GroundwaterMSDNRDDKLDALLGSRRIEPARQDLAARIILQAQSLPQIQNISFWQSVRQLFAEFRLPKPAYVLATALILGMLLGFHLEPEYAGLNETNSQAAQSYLSGEEGLL
Ga0209706_1029600623300027818Freshwater SedimentNQDEKLDAMLRQRRVEPTSLDLAERIILRAQSLPQAQNISLWNAVRQLFVEFHLPKPGYVLATALVLGMVLGFSTVPDNGQNGDAGTATAQSYIVGDEGLL
Ga0209382_1059735023300027909Populus RhizosphereMSEIQDEKLDRMLHSRRVEPASQDLAARIILKAQSLPQVQNISLWQGVRQLFAEFHLPQPGYVLATALVLGMMLGFGTAPENDLSSDASSVTAQISIAGDEELL
Ga0326597_1010081133300031965SoilMSENQDDKLARLLRSRRTEAASPDLAARIILQAQSLPQVQNISLWQAVRQLFAEFHLPKPGYVFAGALVLGMVVGFSTAPENVQSSDASSSTAQSYIAGDEGLL
Ga0315910_1111548823300032144SoilMSANRDEKLESMLRQRRAEPASPDLAERIILRAQSLPQGQNISLWSAVRQLFAEFHLPKPGYVLASALILGMVLGFSTAPDNGQNGDTGSATAQSYFSGDEGLL
Ga0316601_10265739923300033419SoilMSENQDEKLESMLRSRRMETVTPDLAGRIILQAQSLPQLQNVPLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSANAQSYIAGDEELL
Ga0316626_1182653123300033485SoilMSENQDEKLESMLRSRRTETVTPDLAGRIILQAQSLPQLQNVPLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASSAIAPSYIAGDEDLL
Ga0364945_0097132_459_7733300034115SedimentMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDANTASAQSYIAGDEELL
Ga0364934_0016887_1173_14873300034178SedimentMSENEDEKLARMLHSRRIEPASHDLAARIILKAQSLPQLESTSLWQAVRQLFAEFHLPKPGYVLASALILGMLLGFNIAPDHSSLNENNSQAAQSFLSGDEELL
Ga0364943_0230738_306_6203300034354SedimentMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSDASTAAAQSYITGDEELL
Ga0364941_166169_1_2673300034417SedimentMSEYQDEKLESMLRSRRTETVAPDLAGRIILQAQSLPQARNISLWQAVRQLFAEFHLPKPGYVLASALVLGMVLGFSTAPENGQLSEAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.