| Basic Information | |
|---|---|
| Family ID | F091549 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILTEPFHSVS |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 5.61 % |
| % of genes from short scaffolds (< 2000 bps) | 5.61 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (95.327 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.149 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.056 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 20.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13360 | PQQ_2 | 76.64 |
| PF13570 | PQQ_3 | 14.02 |
| PF01678 | DAP_epimerase | 3.74 |
| PF09678 | Caa3_CtaG | 0.93 |
| PF14559 | TPR_19 | 0.93 |
| PF02113 | Peptidase_S13 | 0.93 |
| PF15919 | HicB_lk_antitox | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 3.74 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 95.33 % |
| All Organisms | root | All Organisms | 4.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004463|Ga0063356_102522947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300005345|Ga0070692_10606404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300005546|Ga0070696_101384290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300010038|Ga0126315_10484637 | Not Available | 787 | Open in IMG/M |
| 3300018429|Ga0190272_10172211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300028380|Ga0268265_10764647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.67% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.93% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1046341242 | 3300000364 | Soil | VTTDSLIYLIDNTIDGRGASPRELRAVLGRVQDGVEILTEPYHAVSLERVTSLRP |
| JGI10216J12902_1003777282 | 3300000956 | Soil | VSTDSLIYLIDNTLDGQGASPRELRAVLGRVWDGVEILTE |
| soilL2_100026324 | 3300003319 | Sugarcane Root And Bulk Soil | VLVYLVDNTVDGQGASPREIRAVLGRLIPGLEILTEPFHNVSLER |
| Ga0055465_100474673 | 3300004013 | Natural And Restored Wetlands | LLVYLVDNTIDGQGASPREIRAVLGRLIPGLEILTEPFHSVSLERV |
| Ga0063356_1025229471 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILTEPFHTVSLERVRSLRPSHIIL |
| Ga0062592_1006682531 | 3300004480 | Soil | LLVYLVDNTINGQGDSPREIRAVLGRLIPGLEILTEPFYNV |
| Ga0062591_1000763711 | 3300004643 | Soil | LLVYLVDNTIDGHGDSPREIRAVLGRLIPGVEILTEPFHTVSLERVRSLK |
| Ga0066671_104976121 | 3300005184 | Soil | LLVYLVDNTIDGQGASPREIRAVLGRLIPGVEILTEPFHTVSLERVRSLRP |
| Ga0065704_108225552 | 3300005289 | Switchgrass Rhizosphere | VSSASLIYLIDNTLGGQGASPRELRAVLSRIQEGVEILTEPYHA |
| Ga0065705_110120761 | 3300005294 | Switchgrass Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHSVSLERVR |
| Ga0070690_1006285341 | 3300005330 | Switchgrass Rhizosphere | VSSSSSLIYLIDNTLDGQGASPRELRAVLGRMQEGVEILTEP |
| Ga0070677_100713161 | 3300005333 | Miscanthus Rhizosphere | LLVYLVDNTIDGQGASPRELRAVLSRLIAGIEILTEPFHGVSLER |
| Ga0068869_1018339991 | 3300005334 | Miscanthus Rhizosphere | LLVYLVDNTIDGQGASPREIRAVLGRLVPGLEILTEPFHNVTLE |
| Ga0070680_1012799312 | 3300005336 | Corn Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHSVSLERVRS |
| Ga0070682_1019950771 | 3300005337 | Corn Rhizosphere | LLIYLIDNTIDGQGDSPRELRAVLCRMRAGLEILTEPFHAV |
| Ga0070691_106117902 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHAVSLERVRS |
| Ga0070692_106064042 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYLIDNTLDGQGASPRELRDALARVCAGDEILTEPFPAVSLERVESLRPSHII |
| Ga0070675_1001625581 | 3300005354 | Miscanthus Rhizosphere | VSSSPSLIYLIDNTLDGQGASPRELRAVLGRMCEGVEILTEP |
| Ga0070688_1008192981 | 3300005365 | Switchgrass Rhizosphere | VSSSSSLIYLIDNTLDGQGASPRELRAVLGRMQEGVEILTEPYHAVSLKRVKSL |
| Ga0070705_1012237182 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNASLIYLIDNTLEGQGASPRELRAVLSRMHEGVEILTEPYHAVSLKRVKS |
| Ga0070662_1001346073 | 3300005457 | Corn Rhizosphere | LLVYLVDNTIDGQGASPRELRAVLGRLIAGIEILTEPFHSVSLERVRSLRPSHI |
| Ga0070662_1003325272 | 3300005457 | Corn Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEAFHSVSLERVRS |
| Ga0070681_118094321 | 3300005458 | Corn Rhizosphere | LLVYLVDNTINGQGDSPREIRAVLGRLIPGLEILIEPFQHVSLERVRSLRPSH |
| Ga0068867_1013388091 | 3300005459 | Miscanthus Rhizosphere | VTSASLIYLIDNTLEGQGASPRELRAVLSRIQEGVEILTEPYHAVSLKRVKSLRPSH |
| Ga0070685_114272642 | 3300005466 | Switchgrass Rhizosphere | LLIYLVDNTIDGQGASPREVRAVLGRLIPGLEILIEPFHNVSLER |
| Ga0070697_1011706812 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIYLVDNTIDGKGARPRELRSVLERLCEGVEILTEPFPAVS |
| Ga0068853_1002869383 | 3300005539 | Corn Rhizosphere | LLVYLVDNTIDGQGASPREIRAVLGRLIPGLEILIEPFQN |
| Ga0070695_1001253963 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSASLIYLIDNTLEGQGASPRELRAVLSRIREGVEILTEPYTRVSLKRVKSLNPSHIVL |
| Ga0070695_1016342892 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAASLIYLIDNTLDGQGASPRELSATLNRMGEGLKILIEP |
| Ga0070696_1013842901 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHSVSLERVRSLRPSHIIL |
| Ga0070696_1018975331 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LSEVTLLVYLVDNTIDGHGDSPREIRAVLGRLIPGVEILTESFHTVSLERVRSLKPS |
| Ga0070693_1016474002 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VSATLIYLIDNTIDGQGDSPRELRAVLGRMRAGLEILTEPFPTVSLK |
| Ga0070665_1014848071 | 3300005548 | Switchgrass Rhizosphere | LLVYLVDNTIDGQGASPREVRAVLGRLIPELEILIE |
| Ga0068861_1025502251 | 3300005719 | Switchgrass Rhizosphere | VTSASLIYLIDNTLEGQGASPRELRAVLSRIQEGVEILTEPYHAVSLKRVKSLRPSHIVL |
| Ga0075428_1015588822 | 3300006844 | Populus Rhizosphere | LLVYLVDNTIDGQGASPREVRAVLGRLIPGLEILIE |
| Ga0079215_103960801 | 3300006894 | Agricultural Soil | MILLVDNTIDGQGASPRELQAALERIRPGLQIRLEPF |
| Ga0099830_111531752 | 3300009088 | Vadose Zone Soil | LLIYLIDNTIDGQGASPRELRAVLGRMRAGLEILTEPFHAVSLK |
| Ga0105243_130737401 | 3300009148 | Miscanthus Rhizosphere | VLVYLVDNTIDGQGASPREIRAVLGRLIPGLEILIEPFQNVSL |
| Ga0075423_114467841 | 3300009162 | Populus Rhizosphere | LLVYLVDNTIDGHGDSPREIRAVLGRLIPGVEILTEP |
| Ga0075423_120108251 | 3300009162 | Populus Rhizosphere | LRIYLIDNTIDGQGASPRELTAALLELRNGVEILTEP |
| Ga0105249_112827331 | 3300009553 | Switchgrass Rhizosphere | VTATLIYLIDNTIHGQGDSPRELRSVLGRLRAGLEILTEPFPTVSLKRIK |
| Ga0126313_106824401 | 3300009840 | Serpentine Soil | LLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILTEPFHSVS |
| Ga0126315_104846371 | 3300010038 | Serpentine Soil | VLVYLVDNTVDGQGASPREIRAVLGRLVPGLEILTEPFHSVSLERVRSLRPSHII |
| Ga0126310_100039041 | 3300010044 | Serpentine Soil | LLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILIEPFQSVS |
| Ga0134124_118064001 | 3300010397 | Terrestrial Soil | VLVYLVDNTVDGQGASPREIRAVLGRLIPGLEILT |
| Ga0134122_110051731 | 3300010400 | Terrestrial Soil | VTSASLIYLIDNTLEGQGASPRELRAVLSRMHEGVEILTEPYHAVSLK |
| Ga0134121_117516191 | 3300010401 | Terrestrial Soil | VTATSLIYLVDNTINGQGDSPRELRAVLGRMREGLEILT |
| Ga0134121_124226502 | 3300010401 | Terrestrial Soil | LLVYLVDNTIDGQGASPREVRAVLGRLIPELEILIEPFHQVSL |
| Ga0134123_132808911 | 3300010403 | Terrestrial Soil | VTNASLIYLIDNTLEGQGASPRELRAVFSRMHEGVEILTEPYHAVSLKRVKSLRPSHIV |
| Ga0137455_10492671 | 3300011429 | Soil | VSSASLIYLIDNTLEGQGASPRELRAVLSRIYEGVEILT |
| Ga0137457_11914131 | 3300011443 | Soil | LLVYLVDNTIDGQGASPREVRAVLGRLIPELEILIEPFHNVSLDRVRS |
| Ga0137463_10089275 | 3300011444 | Soil | VTSKSLIYLVDNTLDGQGASPRELRAVLGRLREGVEILTE |
| Ga0137390_108114631 | 3300012363 | Vadose Zone Soil | MPASLVYLIDNTLDGQGPSPRELRAALGRVREGLEILIEPYHAV |
| Ga0157296_102394001 | 3300012905 | Soil | VIYLIDNTIDGQGASPRELRSALKRVRPEMEILTEPFSEV |
| Ga0137394_105589291 | 3300012922 | Vadose Zone Soil | VTNASLIYLIDNTLEGQGASPRELRAVLSRMHEGV |
| Ga0137359_117547282 | 3300012923 | Vadose Zone Soil | VTTASLIYLIDNTLDGQGASPRELRAVLGRIQEGAEI |
| Ga0137407_114110021 | 3300012930 | Vadose Zone Soil | LLIYLIDNTIHDQGDSPRELRAVLGRMREGLEILTEPFQSVSLKRVKSLKPSHII |
| Ga0164303_113092312 | 3300012957 | Soil | LLIYLVDNTIDGQGASPREVRAVLGRLIPGLEILIEPFHHVSLERVRSLKP |
| Ga0164302_109036851 | 3300012961 | Soil | LLIYLIDNTIDGQGDSPRELRAVLGRMRAGLEILAEPFHAVSLKRIKSL |
| Ga0164309_115516842 | 3300012984 | Soil | LLIYLVDNTIDGQGASPREVRAVLGRLIPGLEILIEPFHHVSLERVRSLK |
| Ga0157373_113710341 | 3300013100 | Corn Rhizosphere | LLVYLVDNTINGQGDSPREIRAVLGRLIPGLEILTE |
| Ga0157371_115723732 | 3300013102 | Corn Rhizosphere | MIYLVDNTINGQGASPRELRSALERVRPEMEIMTEPFSEVSLQRI |
| Ga0157378_105128771 | 3300013297 | Miscanthus Rhizosphere | LLVYLVDNTIDGQGASPRELRAVLGRLIAGIEILTEPFHGVSLERVRSLR |
| Ga0157378_111526041 | 3300013297 | Miscanthus Rhizosphere | LLVYLIDNTIDGQGGRPRYIRAVLRRLSPVLEILIEPFQNVSLDRVRSLRP |
| Ga0163162_110396441 | 3300013306 | Switchgrass Rhizosphere | LLVYLVDNTIDGQGASPREIRAVLGRLIPGLEILTEPFHTVSLERV |
| Ga0163162_111681772 | 3300013306 | Switchgrass Rhizosphere | VSSASLIYLIDNTLEGQGASPRELRAVLSRIQEGVEILTEPYHAVSLK |
| Ga0075327_10892392 | 3300014272 | Natural And Restored Wetlands | LLVYLVDNTIDGQGVSPREIRAVLGRLISGLEILTE |
| Ga0163163_105184992 | 3300014325 | Switchgrass Rhizosphere | VTSASLIYLIDNTLEGQGASPRELRAVLSRIQEGVEI |
| Ga0137405_10176002 | 3300015053 | Vadose Zone Soil | VTNASLIYLIDNTLEGQGASPRELRAVLSRMHEGVEILTEP |
| Ga0167623_10110541 | 3300015161 | Glacier Forefield Soil | MSASLVYLIDNTIDGKGASPRELRAGLQRVHDRLEIVTEPYQAVSLERLEAIRPSHIV |
| Ga0180077_10945651 | 3300015255 | Soil | VTNASLIYLIDNTLEGQGASPRELRAVLSRMHEGVEILTEPYHAVSLKRVKSLRPSHIVL |
| Ga0132256_1019309791 | 3300015372 | Arabidopsis Rhizosphere | LRIYLIDNTIDGQGASPRELSAALLELRNGVEILTEPFNAVSLSRVNSLQPSHIV |
| Ga0132257_1003876093 | 3300015373 | Arabidopsis Rhizosphere | LLVYLVDNTIDGHGDSPREIRAVLGRLIPGVEILTEPFHAVSLERVRSLKPSHI |
| Ga0132255_1006221841 | 3300015374 | Arabidopsis Rhizosphere | LLVYLVDNTVDGHGDSPREIRAVLGRLIPGVEILTEPFHAVS |
| Ga0184608_104885771 | 3300018028 | Groundwater Sediment | VSGLIYLIDNTLDGQGPSPRELRAVLGRMREGVEILIEPYHS |
| Ga0190265_109251361 | 3300018422 | Soil | MLIYLVDNTIENKGDSPRELRAVLGRLIPGLEILT |
| Ga0190272_101722111 | 3300018429 | Soil | MLIYLVDNTIDGQGASPRELRGILGRLRPGVEILTEPFGAVSLDRIRDLSPSHIVL |
| Ga0066667_106200592 | 3300018433 | Grasslands Soil | VTTASLIYLIDNTLDGQGASPRELRAVLGRMREGAEILSEPFHAVS |
| Ga0190269_113232631 | 3300018465 | Soil | MIYLVDNTIDGQGASPGEIRAALARINPDVEVLAEPFSSVSPERVQS |
| Ga0190268_110448032 | 3300018466 | Soil | LLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILTEPFHSVSLERVRSL |
| Ga0190274_125833341 | 3300018476 | Soil | VSGSTSLIYLIDNTLDGQGASPRELRAVLGRMREGVEILTEPYH |
| Ga0190273_120062571 | 3300018920 | Soil | MIYLIDNTIDGQGASPREIRVTLERIRPDLELLTE |
| Ga0187892_105245302 | 3300019458 | Bio-Ooze | MLIYLIDNTIDGQGASPRELRAVLGRMRQEVEILTESFR |
| Ga0193717_11170381 | 3300020060 | Soil | VIYLIDNTIDGQGASPRELRAVLGRLRPAVDILVEPFQA |
| Ga0210378_102387242 | 3300021073 | Groundwater Sediment | MLIYLVDNTINGQGASPRELRAVLGRLRPEVEILTEPFSAVSLD |
| Ga0213882_103406793 | 3300021362 | Exposed Rock | MIYLIDNTIDGQGASPREIREALGRVRPEAEVLMEPFHAVSLERV |
| Ga0207710_102372532 | 3300025900 | Switchgrass Rhizosphere | LLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILTEP |
| Ga0207645_112350631 | 3300025907 | Miscanthus Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILT |
| Ga0207660_115278682 | 3300025917 | Corn Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHSVSLE |
| Ga0207690_116392371 | 3300025932 | Corn Rhizosphere | LLIYLIDNTIDGQGASPREVRAVLGRLIPGLEILIEPFHNVTLERV |
| Ga0207706_108081172 | 3300025933 | Corn Rhizosphere | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHSVSLERVRSLRP |
| Ga0207665_108703233 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVYLVDNTIDGHGDSPREIRAVLGRLIPGVEILTEPFHAVSL |
| Ga0207711_115026862 | 3300025941 | Switchgrass Rhizosphere | LLVYLVDNTIDGQGASPRELRAVLSRLIAGIEILTEPFHSVSLERVRSLRPS |
| Ga0207679_114344001 | 3300025945 | Corn Rhizosphere | LLVYLVDNTIDGQGASPREVRAVLGRLIPELEILIEPFHQVS |
| Ga0207648_112615491 | 3300026089 | Miscanthus Rhizosphere | VLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILI |
| Ga0207648_115956011 | 3300026089 | Miscanthus Rhizosphere | VTSASLIYLIDNTLEGQGASPRELRAVLSRIQEGVEILTEP |
| Ga0207675_1022966191 | 3300026118 | Switchgrass Rhizosphere | VLVYLVDNTIDGQGASPRELRAVLGRLIPGLEILIEPFQN |
| Ga0268265_107646471 | 3300028380 | Switchgrass Rhizosphere | VSSASLIYLIDNTLEGQGASPRELRAVLSRIQEGVEILTEPYHAVSLKRVKSLRPSHIVL |
| Ga0272482_100668232 | 3300028578 | Soil | MLIYLVDNTIDGQGASPRELRAALGRICDGCEILTEPFH |
| Ga0307504_100558971 | 3300028792 | Soil | VIYLVDNTLDGQGASPRELQAVLRRLNEGIEILTEPF |
| Ga0307469_122949551 | 3300031720 | Hardwood Forest Soil | VTRVTRASLIYLIDNTLDGQGASPRELRAVLSRMHEGVEILTEP |
| Ga0307405_111001082 | 3300031731 | Rhizosphere | MLIYLVDNTIDGRGVSPRELRAVLGLLRPEAEILTEPFREVSLERVR |
| Ga0307468_1001693941 | 3300031740 | Hardwood Forest Soil | VTTDSLIYLIDNTLDGRGASPRELRAVLGRVQDGVEILTEPYHAVSLQRVKSLRP |
| Ga0310891_101172151 | 3300031913 | Soil | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPF |
| Ga0315912_100231306 | 3300032157 | Soil | LLVYLVDNTIHGKGDSPRELRAVLGRLIPGLEILTEP |
| Ga0310889_1000033410 | 3300032179 | Soil | MLVYLVDNTIENKGDSPRELRAVLGRLIPGIEILTEPFHAVSLERVRSLRPS |
| Ga0334962_009020_1026_1187 | 3300034144 | Sub-Biocrust Soil | MIYLVDNTIDGQGASPREILAALKRLRPKTEVRVEPYPQVSLERLLELSPTHVI |
| ⦗Top⦘ |