 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F091526 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRRGPKPAKSKEAKPPVIRKSPKDDAARVRDLEKRLAEA |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 8.41 % |
| % of genes from short scaffolds (< 2000 bps) | 7.48 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.589 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (40.187 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.813 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.486 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13424 | TPR_12 | 4.67 |
| PF13565 | HTH_32 | 3.74 |
| PF02371 | Transposase_20 | 3.74 |
| PF00072 | Response_reg | 2.80 |
| PF04392 | ABC_sub_bind | 2.80 |
| PF01548 | DEDD_Tnp_IS110 | 2.80 |
| PF04973 | NMN_transporter | 2.80 |
| PF12973 | Cupin_7 | 1.87 |
| PF13683 | rve_3 | 1.87 |
| PF13358 | DDE_3 | 1.87 |
| PF13518 | HTH_28 | 1.87 |
| PF09832 | DUF2059 | 0.93 |
| PF13185 | GAF_2 | 0.93 |
| PF07040 | DUF1326 | 0.93 |
| PF04185 | Phosphoesterase | 0.93 |
| PF08734 | GYD | 0.93 |
| PF07721 | TPR_4 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF04519 | Bactofilin | 0.93 |
| PF09723 | Zn-ribbon_8 | 0.93 |
| PF14534 | DUF4440 | 0.93 |
| PF00296 | Bac_luciferase | 0.93 |
| PF01590 | GAF | 0.93 |
| PF00144 | Beta-lactamase | 0.93 |
| PF00067 | p450 | 0.93 |
| PF00128 | Alpha-amylase | 0.93 |
| PF00230 | MIP | 0.93 |
| PF00665 | rve | 0.93 |
| PF00486 | Trans_reg_C | 0.93 |
| PF01734 | Patatin | 0.93 |
| PF00496 | SBP_bac_5 | 0.93 |
| PF00501 | AMP-binding | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 6.54 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 2.80 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.80 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.93 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.93 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.93 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.93 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.93 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.93 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.93 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.93 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.93 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.93 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.59 % |
| All Organisms | root | All Organisms | 8.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004633|Ga0066395_10141551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1209 | Open in IMG/M |
| 3300005332|Ga0066388_100474113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1891 | Open in IMG/M |
| 3300005713|Ga0066905_100026351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3210 | Open in IMG/M |
| 3300005764|Ga0066903_101253507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1381 | Open in IMG/M |
| 3300006904|Ga0075424_100637834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1137 | Open in IMG/M |
| 3300010398|Ga0126383_10415995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1385 | Open in IMG/M |
| 3300010398|Ga0126383_13671163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300018089|Ga0187774_10712877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
| 3300027874|Ga0209465_10165835 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1099 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 40.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101755022 | 3300000597 | Forest Soil | MGRGPKPAKSKVEAKPPATRKSPKGADARVPDLEKRLAEALQREAEALRDK |
| JGI1027J12803_1080107001 | 3300000955 | Soil | MGRDPKPAKSKVGAKRSISPKPPKSDGATIRDLEKRL |
| Ga0066397_101106601 | 3300004281 | Tropical Forest Soil | MSRGPKPAKSREAKPPVARKPSEADDARVGDLENRLAEAL |
| Ga0066395_101415513 | 3300004633 | Tropical Forest Soil | MRRGPKPAKSKGATPPVARQSPKDDGARVRDLETRLAEAL |
| Ga0066388_1000409331 | 3300005332 | Tropical Forest Soil | MGRGPKPAKDKEAKPAVARKSPKNEDSKVRDLEKRLAEALKRE |
| Ga0066388_1004741131 | 3300005332 | Tropical Forest Soil | MRRGRKPAKSKEAKRPAAHKSAKGDGASVRDLEKRLTEALKREAEA |
| Ga0066388_1084260831 | 3300005332 | Tropical Forest Soil | MPRGPKPAKSTVGAKPPVARKLPKANARVRDLEKRLAEALEREAEGREQQ |
| Ga0066905_1000263511 | 3300005713 | Tropical Forest Soil | MRRGPRPTKSKEAKLPVTPRPPKEDGARFRDLEKRLEEALKGEAEA |
| Ga0066905_1015052453 | 3300005713 | Tropical Forest Soil | MRHRGPKPAKAKVQAKPPVARKSPKNKGSEDGGLEKRLAEA |
| Ga0066905_1020026882 | 3300005713 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVARKAPKGNARVRDLEKRLAEALK |
| Ga0068861_1005234203 | 3300005719 | Switchgrass Rhizosphere | MGRGPKPAKSKEAKPSVARKSPKNEGSRVHDLEKRLAEAVE |
| Ga0066903_1012535071 | 3300005764 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVARKSPQAEAARVRDLEKRLEEALKGKAEAL |
| Ga0066903_1026196302 | 3300005764 | Tropical Forest Soil | MGRGPKPAKEKVEAKPAVSRKSSKETDARVRDLERLAGALRD |
| Ga0066903_1050271281 | 3300005764 | Tropical Forest Soil | MRRGPKPAKSKEAKCPVARKSSKNDGKVRDLETRLAEALQREADASKREAEALEQQ |
| Ga0075417_100201105 | 3300006049 | Populus Rhizosphere | MRRGTRPTKPKVDSKRPVAPKSRKTESSKVRDLENRLAEALQREAAAAKREAEALEQQAATSKIL |
| Ga0075430_1016232461 | 3300006846 | Populus Rhizosphere | MRRGPKPAKSKEAKLPIARKSPKDDGAKVRDLEKR |
| Ga0075433_116804692 | 3300006852 | Populus Rhizosphere | MRRGPQPAKSKAKSPVARKSPKGEGARVHDLEKRLDEA |
| Ga0075424_1006378341 | 3300006904 | Populus Rhizosphere | MGRGQKPAKSKEAKPPVARKSPKDDGDRVRHLEERLAEALRDK |
| Ga0075424_1024670693 | 3300006904 | Populus Rhizosphere | MDRRGKPKKVKAKAQRPVVRKSKGDSAKVRDLEKRLAE |
| Ga0075418_108093042 | 3300009100 | Populus Rhizosphere | MGRGQKPAKSKEAKPPVAHKSSKNGAARVSDLEKRLAEALR |
| Ga0075418_111904482 | 3300009100 | Populus Rhizosphere | MRRGPKPAKSKEAKRPVGRKSPKADAGVRDLEKRLAEA |
| Ga0114129_101749581 | 3300009147 | Populus Rhizosphere | MRRGPKPAKSKEAKPSVTPKSPKDNGSKVQDLEKRLAEALQREAEGLKREAVAQEQQ |
| Ga0114129_134823651 | 3300009147 | Populus Rhizosphere | MRRGPKPAKSKEAKPPVTRKSPKNDARVLDLEKRLAEAQEQQA |
| Ga0126374_102202822 | 3300009792 | Tropical Forest Soil | MRRIPKPTKSKEAKPPVARKAPKDANSRARDFEKRLAEAQQREA |
| Ga0126380_113350371 | 3300010043 | Tropical Forest Soil | MPRGSKPAKSKEAKHPGARKSPKTDDGARVRDLEKQLA |
| Ga0126384_102790641 | 3300010046 | Tropical Forest Soil | MRRGPKPAKSKEAKLPVARKSPKDDPRVCDLEKRLAEALQRETEG |
| Ga0126384_105744551 | 3300010046 | Tropical Forest Soil | MRRGPKAAKSKVEPKPSASRKSSKSDDDQVRDLEKRLAEAQQREAEALKREADALR |
| Ga0126382_102492092 | 3300010047 | Tropical Forest Soil | MRRGPQPAKSKEAKASRVRKTPKDDGTSVRDLEKRLAEALKREAEARDQQTATSE |
| Ga0126382_104065711 | 3300010047 | Tropical Forest Soil | MGRGPKPTKSKEANPPIARKSPKDDSARVRDLEKRLAEALKDKAEALEQQT |
| Ga0126382_106174131 | 3300010047 | Tropical Forest Soil | MRRGPKSAKSKEAKPSVAGKSPKDDRARVRDLYKRLGEA |
| Ga0126382_108031581 | 3300010047 | Tropical Forest Soil | MRRGPKPKKSKEAKPPVARKSSKDDATRLRELEARLEEALRGRAQALKL |
| Ga0126382_117594442 | 3300010047 | Tropical Forest Soil | MSRGPKPAKSKEAKPPSARRSPKNDGARVRDLEKR |
| Ga0126370_112540081 | 3300010358 | Tropical Forest Soil | MGQAPTPAKDKEAKPLVDPKSSKDDCAKVGDLEKRLEEALKGKAEALGQLQ |
| Ga0126376_106078312 | 3300010359 | Tropical Forest Soil | MRRSPKPAKPKVEAKAPGARKSPKNEDSRVRNLEQR |
| Ga0126376_108613252 | 3300010359 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVARKSPKDDGARVRDLEKRLE |
| Ga0126376_123404312 | 3300010359 | Tropical Forest Soil | MRRGSKPAKSKEAKPSVARKSPKDDARVRDLEKRLEEALKGKAEAPTRGVPEAM* |
| Ga0126376_126281502 | 3300010359 | Tropical Forest Soil | MRRGPKPTKSKEAKLPVARKSPEDDDGRGRDLEKRLAEALKRE |
| Ga0126372_100560133 | 3300010360 | Tropical Forest Soil | MGRGPKPAKSKEAKPPVGPKSSKDDAARVRDLDKQLAEAQ |
| Ga0126372_108181143 | 3300010360 | Tropical Forest Soil | MRRGPKPAKSKEAKLPAVRKSPKGDGARVRDLEKR |
| Ga0126372_113218011 | 3300010360 | Tropical Forest Soil | MRRSPKPAKSKPPVTRKSPKDDGARVRDLERRLAE |
| Ga0126372_122439911 | 3300010360 | Tropical Forest Soil | MARGPKPAKSSVEPKPSVARKSSKDDTRVRDLEKRLAEAQQHEAEALKREAE |
| Ga0126378_104851811 | 3300010361 | Tropical Forest Soil | MRRGPKPAKSNEAQTPVARNPQKDDSARVRNLESRLEEALKGKTEALKREADA |
| Ga0126377_103655362 | 3300010362 | Tropical Forest Soil | MRRGPKPAKSKEAKPSVARKSAKDDGAGIGHVEKRLAEAVQREAEALGQLQASK |
| Ga0126377_106500071 | 3300010362 | Tropical Forest Soil | MRRGPKPAKSKEAKPSASRKPPKDEDTRVRDLEKRLAEALKLKVEALE |
| Ga0126377_107802621 | 3300010362 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVIRKSPKDDAARVRDLEKRLAEA |
| Ga0126377_112431291 | 3300010362 | Tropical Forest Soil | MRRSPKPAKSREAKRPVTRKSSKNESAAVRDLEKRLAEA |
| Ga0126377_124242892 | 3300010362 | Tropical Forest Soil | MGRGPKPAKSKVGAKRPVSPKSPKSDDARVRDLEKRLAEALKR |
| Ga0126377_131642552 | 3300010362 | Tropical Forest Soil | MRRGPKPAKSKGAKPPVGRKLPKDDSARVRDLERQLAEA |
| Ga0126377_133595081 | 3300010362 | Tropical Forest Soil | MGRGPKPAKDKEAKPPAARKAPKDNARVRDLEKRLAEA |
| Ga0126379_108430802 | 3300010366 | Tropical Forest Soil | MGQGPKPAKSKKAKPPVARKSPKDDGAEVRDLKKRLAEAQQHEAEALKREAEA |
| Ga0126379_111348501 | 3300010366 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVVRKSSKDDARIRDLELRLEEALKGKAEAPTRGVPEAM* |
| Ga0126383_104159954 | 3300010398 | Tropical Forest Soil | MRRGPKPAKSKEAKLPVTPRPPKEDGARFRDLEKRL |
| Ga0126383_110326451 | 3300010398 | Tropical Forest Soil | MPMRRGPKPAKSKEAKPPAARKSPKADARVRDLEKRLAEALQREA |
| Ga0126383_116579051 | 3300010398 | Tropical Forest Soil | MRRGPKPAKSKVEAKIPVAKRSLKNGGSRDRELENRLAEALTQQKATADLLHMRNR |
| Ga0126383_119426882 | 3300010398 | Tropical Forest Soil | MRRGPKPAKADGKGKPSVGRKSPTDDAKVRDLEKRLE |
| Ga0126383_129866541 | 3300010398 | Tropical Forest Soil | MGRGPKPAKATEAKSPAIRKSPKAEDARVRDLEKQLAEER |
| Ga0126383_135447931 | 3300010398 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVARKSPQAEAARVRDLEKRLEEALKG |
| Ga0126383_136711632 | 3300010398 | Tropical Forest Soil | MRRGPKPTKSKEGKPSGPRKSPKDDGARVHDLEKRLEEALKEKAEALNL |
| Ga0134127_101006921 | 3300010399 | Terrestrial Soil | MRRGPKPAKSNEAKLPIARKSPKDDGAKVRYLEKRLAEAL |
| Ga0124850_10139173 | 3300010863 | Tropical Forest Soil | MRRGSKPAKSKDAESPVARKSPKGDARVRDLEARLAEALREKAEALGQLQTS |
| Ga0137367_104842823 | 3300012353 | Vadose Zone Soil | MRRRGPKPAKSKEAKPPIVRKSPKNDVASVRDLEK |
| Ga0126375_101477424 | 3300012948 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVGRQSPKDDGRVLETRLAE |
| Ga0126375_108150621 | 3300012948 | Tropical Forest Soil | MRRGPKPKKSEAKAKPRVARKSPKNEDGRFRDLEKRLAAA |
| Ga0126375_109612501 | 3300012948 | Tropical Forest Soil | MRRGPKPAKSKEGKPPVTRKSSKDDGRVRDLQKRLGEALKRETEALERETATSGI |
| Ga0126375_110447192 | 3300012948 | Tropical Forest Soil | MGRGSKPAKSKVGAKPQVTRKSPKSDGARVSDLEERLAEALRDKAE |
| Ga0126369_101163783 | 3300012971 | Tropical Forest Soil | MGRGPKPAKSKEAKSPVTRKSPKDGAATVRDLEKRLAEALGQL |
| Ga0126369_103093321 | 3300012971 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVARKAPKGNARVRDLEKRLA |
| Ga0126369_108806081 | 3300012971 | Tropical Forest Soil | MRRGPKPAKSKEAKPPVARKSPQAEAARVRDLEKRLEEALKGKAEALR |
| Ga0126369_119001881 | 3300012971 | Tropical Forest Soil | MRPGPKPAKSKEAKPPVARKSPQAEAARVRDLEKRLEEALKGKAEALR |
| Ga0182036_109557641 | 3300016270 | Soil | VRRGPKPEKSKAAKPPVARKSPKNDGARVRDLEKLLTE |
| Ga0182041_107313921 | 3300016294 | Soil | MRQGPKPAKSKEAKSPVGRKSPKNDGARARDLEKRLEEA |
| Ga0182033_101492971 | 3300016319 | Soil | MRRGPKPAKSKEAKPPVARTSSKGDDARVRDLEKRLAEALQREAEASKRAAKAD |
| Ga0182033_115308411 | 3300016319 | Soil | MPRGPKPAKPKLGAKPPVARKSAKDDGAKVRDLEKR |
| Ga0182034_104065943 | 3300016371 | Soil | MRRGPKPAKSKEAKPPVARQSPKGDGARVSDLENRLAEALA |
| Ga0187774_107128773 | 3300018089 | Tropical Peatland | MLRGPKPAKSKEAKSPVARKSPKNDSARVRDLEKRLASVLEREADAQAR |
| Ga0207684_115320632 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRGPKPTKSKEAKPPVARKSPKGNARVRDLETRLA |
| Ga0209377_12411312 | 3300026334 | Soil | MGRGPKPTKSKEGKPPVARKSSKGDGSRVRDLEKRWAEALQREA |
| Ga0209465_101389772 | 3300027874 | Tropical Forest Soil | MGRGPKPAKATEAKSPAIRKSPKAEDARVRDLEKQLAEERRD |
| Ga0209465_101658351 | 3300027874 | Tropical Forest Soil | MRRGPKPAKSKGATPPVARQSPKDDGARVRDLETRLAEALAREKATGEILR |
| Ga0318516_102257902 | 3300031543 | Soil | MRRGPKPAKSKEAKPPVARTSSKGDDARVRDLEKRLAEALQREAEASKRAAEADSGSM |
| Ga0318516_107502111 | 3300031543 | Soil | MRRRPRPAKSKEAKPPTTRKSPKDSAARVRDLEKRLTEALKGKADALRDKAEA |
| Ga0318528_107316562 | 3300031561 | Soil | MRQGPKPAKSKEAKSPVGRKSPKNDGARARDLEKRLEE |
| Ga0318573_104941162 | 3300031564 | Soil | MRRGPKPAKSKEAKPPVARTSSKGDDARVRDLEKRLAEALQREAE |
| Ga0318561_100965161 | 3300031679 | Soil | MRRGPKPAKSKEAKPPSARKSPKNEDSRVRDLEQRLAEALR |
| Ga0307469_111824241 | 3300031720 | Hardwood Forest Soil | MRRGSKPAKAKPKVAAKPQVARPSRKQGDARVRDLEKRLAEALTREAEAL |
| Ga0307468_1000197215 | 3300031740 | Hardwood Forest Soil | MRRGPKPAKSKEAKPSVARKSPKNEGSRIRDLEKRLA |
| Ga0307468_1001158383 | 3300031740 | Hardwood Forest Soil | MPRGPKPAKSKEAKPLVASKLPKRDGARVRDLETRLAEALRDKAD |
| Ga0318546_113423661 | 3300031771 | Soil | MRQGPKPAKSEEAKPPVGRKSPKDDSGKVREVEERLEEALR |
| Ga0318566_100540343 | 3300031779 | Soil | MRRGPKPAKSKSESKRPVYPKSSKGDGARVGDLETRL |
| Ga0318557_101061972 | 3300031795 | Soil | MRRGPKPAKSKEAKPPVARQSPKGDGARVSDLENRLAEALAQQA |
| Ga0307473_114097551 | 3300031820 | Hardwood Forest Soil | MRRGAKPANAKVEAKPLSPAKSPPNDGARIRDLEKRLAEA |
| Ga0318511_105028882 | 3300031845 | Soil | MGRGPKPAKSKVEAKPPASRKPPQSVDAGVQDLEKRLKEALG |
| Ga0318527_100850912 | 3300031859 | Soil | MRRGPKPAKSKEAKPPVARQSSKDDGAKVRDLENRLAEALAQ |
| Ga0306919_101917041 | 3300031879 | Soil | MRRGPKPAKSKEAKPPVARQSPKGDGARVSDLENRLAEALAQQAATSDILKVISRSTFD |
| Ga0318544_102395922 | 3300031880 | Soil | MRQGPKPAKSKEAKSPVGRKSPKNDGARARDLEKRLEEAL |
| Ga0306925_109257192 | 3300031890 | Soil | MPRGPKPAKSKEAKPLGGRKSPKDDTSRVRDLEKRLAEAQEQQAAA |
| Ga0318536_101162711 | 3300031893 | Soil | MRRGPKPAKSKEAKPPVARQSPKGDGARVSDLENRLAEALAQQAATSDILKVIS |
| Ga0310912_102161292 | 3300031941 | Soil | MRRGPKPAKSKGDAKPPVPRESPKNEDSRVRDLEK |
| Ga0310912_106487652 | 3300031941 | Soil | MRRGPKPAKSKEAKPLGGRKSPKDDTSRVRDLEKRLAE |
| Ga0310916_100323681 | 3300031942 | Soil | MRRGPKPAKSKEAKPPVARQSPKGDGARVSDLENRLAEALAQQAATSDI |
| Ga0318558_102041551 | 3300032044 | Soil | MRRSPKPAKSKVAKPPVARKSPEDDARVRDLEKQLAEALRN |
| Ga0318575_104439902 | 3300032055 | Soil | MRRGPKPAKSKEAKPPVARTSSKGDDARVRDLEKRLAEALQREAEAS |
| Ga0318504_100642341 | 3300032063 | Soil | MRRGPKPAKSKSESKRPVYPKSSKGDGARVGDLETRLAEALQREAEALK |
| Ga0318514_101287822 | 3300032066 | Soil | MPRGPKPAKSKVEAKPAVTRKPPEADAARVSDLERRLGETLGQLQTRDRE |
| Ga0318553_102099382 | 3300032068 | Soil | MRRGPKPAKSKEAKPPVARQSPKGDGARVSDLENRLAEALAQQAATSDILK |
| Ga0307470_108940272 | 3300032174 | Hardwood Forest Soil | MGRGPKPAKRKVEAESPVSRKSPKHEDARVRDLEK |
| Ga0307471_1022569141 | 3300032180 | Hardwood Forest Soil | MGRGPKPATGKVEAKSPASRKSPKHEDARVRDLEERLAEALGQLQTRN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |