| Basic Information | |
|---|---|
| Family ID | F091517 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.92 % |
| % of genes near scaffold ends (potentially truncated) | 25.23 % |
| % of genes from short scaffolds (< 2000 bps) | 79.44 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.196 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.888 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.402 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.10% β-sheet: 0.00% Coil/Unstructured: 58.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 28.04 |
| PF02548 | Pantoate_transf | 8.41 |
| PF13480 | Acetyltransf_6 | 7.48 |
| PF01565 | FAD_binding_4 | 4.67 |
| PF04127 | DFP | 2.80 |
| PF07690 | MFS_1 | 1.87 |
| PF01345 | DUF11 | 0.93 |
| PF03309 | Pan_kinase | 0.93 |
| PF02558 | ApbA | 0.93 |
| PF05977 | MFS_3 | 0.93 |
| PF02678 | Pirin | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 8.41 |
| COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 2.80 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 0.93 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.93 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.20 % |
| Unclassified | root | N/A | 2.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004156|Ga0062589_101157301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 737 | Open in IMG/M |
| 3300004463|Ga0063356_100532337 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300004463|Ga0063356_104528936 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300004480|Ga0062592_101608588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 628 | Open in IMG/M |
| 3300005093|Ga0062594_101778276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300005166|Ga0066674_10220671 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300005180|Ga0066685_10164036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1516 | Open in IMG/M |
| 3300005187|Ga0066675_10074626 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300005294|Ga0065705_10781126 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005328|Ga0070676_10069921 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300005338|Ga0068868_100337874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1287 | Open in IMG/M |
| 3300005444|Ga0070694_100946010 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005446|Ga0066686_10004245 | All Organisms → cellular organisms → Bacteria | 6663 | Open in IMG/M |
| 3300005451|Ga0066681_10273763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1028 | Open in IMG/M |
| 3300005467|Ga0070706_100082331 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300005467|Ga0070706_101025562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 760 | Open in IMG/M |
| 3300005468|Ga0070707_101766110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
| 3300005471|Ga0070698_100454514 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300005546|Ga0070696_100016277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii | 5003 | Open in IMG/M |
| 3300005547|Ga0070693_100897844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
| 3300005557|Ga0066704_10641666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300006046|Ga0066652_101570123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
| 3300006049|Ga0075417_10023893 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300006049|Ga0075417_10067354 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300006049|Ga0075417_10107185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1272 | Open in IMG/M |
| 3300006852|Ga0075433_10169204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1945 | Open in IMG/M |
| 3300006876|Ga0079217_10044044 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300006894|Ga0079215_10470905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 771 | Open in IMG/M |
| 3300006918|Ga0079216_10489470 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300007004|Ga0079218_10536425 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300007004|Ga0079218_12939678 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009012|Ga0066710_101420486 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300009148|Ga0105243_10016212 | All Organisms → cellular organisms → Bacteria | 5639 | Open in IMG/M |
| 3300009166|Ga0105100_10677517 | Not Available | 635 | Open in IMG/M |
| 3300010301|Ga0134070_10467126 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010304|Ga0134088_10028370 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300010333|Ga0134080_10177086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 915 | Open in IMG/M |
| 3300010400|Ga0134122_10105936 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300010400|Ga0134122_12602444 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012189|Ga0137388_10900479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 818 | Open in IMG/M |
| 3300012204|Ga0137374_10086816 | All Organisms → cellular organisms → Bacteria | 3006 | Open in IMG/M |
| 3300012206|Ga0137380_10489032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1085 | Open in IMG/M |
| 3300012206|Ga0137380_11274262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300012207|Ga0137381_10249284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1543 | Open in IMG/M |
| 3300012211|Ga0137377_10105193 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300012355|Ga0137369_10151623 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300012358|Ga0137368_10394037 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012359|Ga0137385_10175651 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300012359|Ga0137385_10618289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 909 | Open in IMG/M |
| 3300012360|Ga0137375_11293582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300012922|Ga0137394_10056340 | All Organisms → cellular organisms → Bacteria | 3253 | Open in IMG/M |
| 3300012925|Ga0137419_10717180 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012927|Ga0137416_10655938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 918 | Open in IMG/M |
| 3300012927|Ga0137416_10920233 | Not Available | 778 | Open in IMG/M |
| 3300012975|Ga0134110_10474480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
| 3300017657|Ga0134074_1393886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300018000|Ga0184604_10004373 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
| 3300018027|Ga0184605_10279057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 758 | Open in IMG/M |
| 3300018028|Ga0184608_10000394 | All Organisms → cellular organisms → Bacteria | 11534 | Open in IMG/M |
| 3300018028|Ga0184608_10366945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 630 | Open in IMG/M |
| 3300018031|Ga0184634_10068351 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300018056|Ga0184623_10040168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2124 | Open in IMG/M |
| 3300018056|Ga0184623_10226060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 858 | Open in IMG/M |
| 3300018071|Ga0184618_10091329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1181 | Open in IMG/M |
| 3300018071|Ga0184618_10284225 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300018074|Ga0184640_10048160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1754 | Open in IMG/M |
| 3300018076|Ga0184609_10106743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1263 | Open in IMG/M |
| 3300018078|Ga0184612_10438883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 651 | Open in IMG/M |
| 3300018429|Ga0190272_12237180 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018431|Ga0066655_10092918 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300018468|Ga0066662_10156110 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300020003|Ga0193739_1003258 | All Organisms → cellular organisms → Bacteria | 4430 | Open in IMG/M |
| 3300021080|Ga0210382_10158747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 971 | Open in IMG/M |
| 3300022756|Ga0222622_10366925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1007 | Open in IMG/M |
| 3300025885|Ga0207653_10000227 | All Organisms → cellular organisms → Bacteria | 37520 | Open in IMG/M |
| 3300025885|Ga0207653_10032218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1695 | Open in IMG/M |
| 3300025907|Ga0207645_10243867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1187 | Open in IMG/M |
| 3300025910|Ga0207684_10680245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 875 | Open in IMG/M |
| 3300025910|Ga0207684_11077242 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025917|Ga0207660_10408445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1094 | Open in IMG/M |
| 3300025918|Ga0207662_10091644 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300025921|Ga0207652_10390744 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300025922|Ga0207646_11448967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300025932|Ga0207690_11717518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300025961|Ga0207712_10655771 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300025981|Ga0207640_10911917 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300026089|Ga0207648_10089671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2686 | Open in IMG/M |
| 3300026118|Ga0207675_100233313 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300026324|Ga0209470_1072890 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300026343|Ga0209159_1289798 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027471|Ga0209995_1065211 | Not Available | 621 | Open in IMG/M |
| 3300027543|Ga0209999_1069660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 674 | Open in IMG/M |
| 3300027665|Ga0209983_1051987 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027691|Ga0209485_1005641 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300027873|Ga0209814_10025111 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
| 3300027873|Ga0209814_10047330 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300027886|Ga0209486_10736750 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300028381|Ga0268264_10567906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1115 | Open in IMG/M |
| 3300028536|Ga0137415_10241429 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300028536|Ga0137415_10418121 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300028715|Ga0307313_10103429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 866 | Open in IMG/M |
| 3300028796|Ga0307287_10083584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1198 | Open in IMG/M |
| 3300028807|Ga0307305_10033665 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300028875|Ga0307289_10190921 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300028881|Ga0307277_10002039 | All Organisms → cellular organisms → Bacteria | 7857 | Open in IMG/M |
| 3300031965|Ga0326597_10998485 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300034178|Ga0364934_0066710 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 11.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062589_1011573011 | 3300004156 | Soil | MDAQRKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR* |
| Ga0063356_1005323372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNADRKTPKEDAQDRARRSRRIHAFLIAWAERHWPERVTRFPKR* |
| Ga0063356_1045289361 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDAKSKTPTSDDTQSARRSRRIHAFLGAWAKRHWPERVTRFAKR* |
| Ga0062592_1016085882 | 3300004480 | Soil | MNEHKTPKDDAQSRARRSRRIHAFLTAWAARHWPERVTRFPKR* |
| Ga0062594_1017782762 | 3300005093 | Soil | MDAKSKTPTSDDTQSARRSRRIHAFLGAWAKRHWPERVTR |
| Ga0066674_102206712 | 3300005166 | Soil | MDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0066685_101640363 | 3300005180 | Soil | MNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVIR |
| Ga0066675_100746261 | 3300005187 | Soil | MDAKRKMPARDDGQARVRRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0065705_107811261 | 3300005294 | Switchgrass Rhizosphere | MESQRKMPERDDRQARARRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0070676_100699213 | 3300005328 | Miscanthus Rhizosphere | MDAQRKVSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR* |
| Ga0068868_1003378743 | 3300005338 | Miscanthus Rhizosphere | MDSQRKMSVRDDGQARARRSRRIHAFLTAWAQRHWPERVTRFPK |
| Ga0070694_1009460102 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVTRFPKR* |
| Ga0066686_100042453 | 3300005446 | Soil | MNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR* |
| Ga0066681_102737632 | 3300005451 | Soil | MDAKTKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0070706_1000823313 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTADRKMPASDDAAARARRSRRIHAFLRRWAERHMPERVTRFPRR* |
| Ga0070706_1010255622 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTADRKMPASDDPAARARRSRRIRAFLRRWAERHMPERVT |
| Ga0070707_1017661102 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVT |
| Ga0070698_1004545143 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQRKTSARDDVQDRARRSHRIHAFLGAWAKRHWPERVTRFAKR* |
| Ga0070696_1000162777 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKRKTAPSDDTRSRARRSRRIHAFLSAWAARHWPERVTRFTKR* |
| Ga0070693_1008978442 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQRKVSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0066704_106416662 | 3300005557 | Soil | MNADRKTPTSDDAQARARRSRRIRAFLRRWADRHMPERVTRFPTR* |
| Ga0066652_1015701231 | 3300006046 | Soil | MDAKTKMPARDDGQARARRSRRIHAFLSAWAQRHW |
| Ga0075417_100238933 | 3300006049 | Populus Rhizosphere | MKDRKKPASETPESRARRSRRIHAFLDRWARRHMPERVTRFTSR* |
| Ga0075417_100673542 | 3300006049 | Populus Rhizosphere | MDAKRKTLTSDDTRTRARRSRRIHTFLGAWAKRHWPERVTRFPKR* |
| Ga0075417_101071852 | 3300006049 | Populus Rhizosphere | MAQPKMADAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR* |
| Ga0075433_101692043 | 3300006852 | Populus Rhizosphere | MDAKRKTLTSDDTRTRARRSRRIHAFLGAWAKRHWPERVTRFPKR* |
| Ga0079217_100440443 | 3300006876 | Agricultural Soil | PDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR* |
| Ga0079215_104709051 | 3300006894 | Agricultural Soil | MTAQRKMTDAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR* |
| Ga0079216_104894702 | 3300006918 | Agricultural Soil | MTAPRKTPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR* |
| Ga0079218_105364251 | 3300007004 | Agricultural Soil | MTAQRKTPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR* |
| Ga0079218_129396782 | 3300007004 | Agricultural Soil | MTAERKTVESKIEAARARRSIRIHAFLTRWAERHWPERVTRFPKR* |
| Ga0066710_1014204862 | 3300009012 | Grasslands Soil | MNADRKQPAGDDAQARARRSRRIHAFLRAWAERHMPERVTRFPAR |
| Ga0105243_100162126 | 3300009148 | Miscanthus Rhizosphere | MNAQRKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR* |
| Ga0105100_106775172 | 3300009166 | Freshwater Sediment | MTAERKTVESKIEAARARRSIRIHAFLTRWADRHWPDRVTHFPKR* |
| Ga0134070_104671262 | 3300010301 | Grasslands Soil | MNADRKQPARDDAQARARRSRRIHAFLRAWAERHMPERVTRFPAR* |
| Ga0134088_100283703 | 3300010304 | Grasslands Soil | MNAERKTPASDEAQARARRSRRIHAFLRRWAERHMPERVTRFPTR* |
| Ga0134080_101770862 | 3300010333 | Grasslands Soil | MNAERKSPASDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR* |
| Ga0134122_101059362 | 3300010400 | Terrestrial Soil | MDAQHKMSERDDGQARARRSRRIQAFLSAWAQRHWPERVTRFRKR* |
| Ga0134122_126024442 | 3300010400 | Terrestrial Soil | SDMDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVTRFTKR* |
| Ga0137388_109004791 | 3300012189 | Vadose Zone Soil | MTADRKMPASDDAAARARRSRQIHAFLHRWAKRHMPERVTRFPRR* |
| Ga0137374_100868165 | 3300012204 | Vadose Zone Soil | SDEKGGPQMNAQRKMPVSDEQARARRSRRIHAFLSAWARRHWPERVIRFAKR* |
| Ga0137380_104890321 | 3300012206 | Vadose Zone Soil | MNADRKQPASDDAQARARRSRRIHAFLRAWAERHMPE |
| Ga0137380_112742622 | 3300012206 | Vadose Zone Soil | MNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVIRFPTR* |
| Ga0137381_102492842 | 3300012207 | Vadose Zone Soil | MNADRKQPASDDAQARARRSRRIHAFLRAWAERHMPERVTRFPAR* |
| Ga0137377_101051932 | 3300012211 | Vadose Zone Soil | MDAKRKMPARDDGHARARRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0137369_101516233 | 3300012355 | Vadose Zone Soil | MNAQRKMPVSDEQARARRSRRIHAFLSAWARRHWPERVIRFAKR* |
| Ga0137368_103940372 | 3300012358 | Vadose Zone Soil | PQMNAQRKMPVSDEQARARRSRRIHAFLSAWARRHWPERVIRFAKR* |
| Ga0137385_101756513 | 3300012359 | Vadose Zone Soil | MNAERKTPASDDAQARARRSRLIHAFLRRWAERHMPERVIRFPTR* |
| Ga0137385_106182891 | 3300012359 | Vadose Zone Soil | MNADRKQPASDDAQARARRSRRIHAFLRAWAERHMPERVTHFPTR* |
| Ga0137375_112935821 | 3300012360 | Vadose Zone Soil | MNADRKMRASDDAAARARRSRRIHAFLDGWAQRHWPDRVTHFGRR* |
| Ga0137394_100563403 | 3300012922 | Vadose Zone Soil | MNADRKKPARENEAARARRSRRIQAFLHRWALRHMPERVTRFSR* |
| Ga0137419_107171802 | 3300012925 | Vadose Zone Soil | YPMKADRKKPATDNAEALARRSRRIHVFLGRWARRHFPERVTRFTSR* |
| Ga0137416_106559382 | 3300012927 | Vadose Zone Soil | MKADRKKPATDNAEALARRSRRIHVFLGRWARRHFPERVTRFTSR* |
| Ga0137416_109202331 | 3300012927 | Vadose Zone Soil | EKGDLEMNAKRKMPARDDGPARARRSRRIHAFLSAWAQRHWPERVTRFPKR* |
| Ga0134110_104744802 | 3300012975 | Grasslands Soil | MDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPK |
| Ga0134074_13938861 | 3300017657 | Grasslands Soil | MNADRKQPAGDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR |
| Ga0184604_100043732 | 3300018000 | Groundwater Sediment | MDSQRKKSERDDGQARARRSRRIHTFLSAWAQRHWPERVTRFAKR |
| Ga0184605_102790571 | 3300018027 | Groundwater Sediment | MDAQHKTPTSDDTQTRERRSRRIHAFLGAWAKRHWPERVTRFAKR |
| Ga0184608_100003948 | 3300018028 | Groundwater Sediment | MDQRKTSVRDDGQARARRSRRIHIFLSAWAERHWPERVTRFPKR |
| Ga0184608_103669451 | 3300018028 | Groundwater Sediment | MDSKRKMSERDDGQARARRSRRIHTFLSAWAQRHWPERVTRFPKR |
| Ga0184634_100683511 | 3300018031 | Groundwater Sediment | MTAERKTPESKIEAARARRSIRIHAFLNRWARRHWPERVTRFPKR |
| Ga0184623_100401683 | 3300018056 | Groundwater Sediment | MTAERKTPNTKVEESRARRSIRIHAFLSRWAERHWPERVTRFPKR |
| Ga0184623_102260602 | 3300018056 | Groundwater Sediment | MTTQRKMTESTIEEARARRSIRIHAFLNRWAQRHWPERVTRFPKR |
| Ga0184618_100913292 | 3300018071 | Groundwater Sediment | MNADRKKPAREIEDARARRSRRIQAFLHRWALRHMPERVTRFSR |
| Ga0184618_102842252 | 3300018071 | Groundwater Sediment | MNADRKKLAKDDAEALARRSKRIHAFLGRWARRHMPARVTRFTR |
| Ga0184640_100481602 | 3300018074 | Groundwater Sediment | MNADRKTPESKIEAARARRSIRIHAFLNRWARRHWPERVTRFPKR |
| Ga0184609_101067432 | 3300018076 | Groundwater Sediment | MTERKTPDTKFEEARARRSIRIHAFLNRWAARHWPERVTRFPKR |
| Ga0184612_104388832 | 3300018078 | Groundwater Sediment | MTTQRKTPDTKFEEARARRSIRIHAFLSRWAARHWPERVTRFPKR |
| Ga0190272_122371802 | 3300018429 | Soil | MTDERKTPDAKFEEARARRSIRIHAFLNRWAARHWPERVTRFPKR |
| Ga0066655_100929183 | 3300018431 | Grasslands Soil | MDAKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR |
| Ga0066662_101561102 | 3300018468 | Grasslands Soil | MDAKRKMPARDDEQSRARRSRRIHAFLSAWAQRHWPERVTRFPKR |
| Ga0193739_10032585 | 3300020003 | Soil | MTAERKTPDSKIEEARARRSIRIHAFLNRWAQRHWPERVTRFPKR |
| Ga0210382_101587472 | 3300021080 | Groundwater Sediment | MDAKRKTPTSDDTRTRLLRSRRIHAFLSAWAERHWPERVTRFPKR |
| Ga0222622_103669252 | 3300022756 | Groundwater Sediment | MDAKRKTPTSDDTRTRLLRSRRIHAFLSAWAERHWP |
| Ga0207653_1000022717 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKSKTPTSDDTQSARRSRRIHAFLGAWAKRHWPERVTRFAKR |
| Ga0207653_100322182 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQRKVSERDGGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR |
| Ga0207645_102438672 | 3300025907 | Miscanthus Rhizosphere | MDAQRKVSERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR |
| Ga0207684_106802451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTADRKMPASDDAAARARRSRRIHAFLRRWAERHMPERVTRFPRR |
| Ga0207684_110772422 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVTRFPKR |
| Ga0207660_104084452 | 3300025917 | Corn Rhizosphere | MDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVT |
| Ga0207662_100916442 | 3300025918 | Switchgrass Rhizosphere | MDAQRKVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR |
| Ga0207652_103907441 | 3300025921 | Corn Rhizosphere | SERNDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR |
| Ga0207646_114489672 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAQSKTPKSDDTQTRARRSRRIHAFLGAWAKRHWPERVTRF |
| Ga0207690_117175181 | 3300025932 | Corn Rhizosphere | MDAQRKVSERDGGQARARRSRRIHAFLSAWAQRHWPERVTRF |
| Ga0207712_106557711 | 3300025961 | Switchgrass Rhizosphere | RKEVADMDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVTRFTKR |
| Ga0207640_109119172 | 3300025981 | Corn Rhizosphere | KVSERDDGQARARRSRRIHAFLSAWAQRHWPERVTRFTKR |
| Ga0207648_100896711 | 3300026089 | Miscanthus Rhizosphere | MDAKRKTAPSDDTHSRARRSRRIHAFLSAWAARHWPERVTRFTKR |
| Ga0207675_1002333133 | 3300026118 | Switchgrass Rhizosphere | MDAQRNVSERDGGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR |
| Ga0209470_10728903 | 3300026324 | Soil | MNAERKTPASDDAQARARRSRRIHAFLRRWAERHMPERVTRFPTR |
| Ga0209159_12897981 | 3300026343 | Soil | AKRKMPARDDGQARARRSRRIHAFLSAWAQRHWPERVTRFPKR |
| Ga0209995_10652112 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MTAERKTIESKIEEARARRSIRIHAFLTRWAEHHWPERVTRFTKR |
| Ga0209999_10696602 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MTAERKTIESKIEEARARRSIRIHAFLTRWAERHWPERVTRFPKR |
| Ga0209983_10519872 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MTAERKTVESKLEAARARRSIRIHAFLTRWAERHWPERVTRFPKR |
| Ga0209485_10056414 | 3300027691 | Agricultural Soil | MTAQRKMTDAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR |
| Ga0209814_100251112 | 3300027873 | Populus Rhizosphere | MAQPKMADAKIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR |
| Ga0209814_100473303 | 3300027873 | Populus Rhizosphere | MDAKRKTLTSDDTRTRARRSRRIHTFLGAWAKRHWPERVTRFPKR |
| Ga0209486_107367501 | 3300027886 | Agricultural Soil | MTAQRKTPDAKIQEARARRSVRIHAFLSRWAQRHWPERVTRFPKR |
| Ga0268264_105679062 | 3300028381 | Switchgrass Rhizosphere | MDAQRKVSERDGGQARARRSRRIHAFLSAWAQRHWPER |
| Ga0137415_102414293 | 3300028536 | Vadose Zone Soil | EKGDLEMNAKRKMPARDDGPARARRSRRIHAFLSAWAQRHWPERVTRFPKR |
| Ga0137415_104181212 | 3300028536 | Vadose Zone Soil | MKADRKKPATDNAEALARRSRRIHVFLGRWARRHFPERVTRFTSR |
| Ga0307313_101034292 | 3300028715 | Soil | MNADRKKPARENEEARARRSRRIQAFLHRWALRHMPERVTRFSR |
| Ga0307287_100835842 | 3300028796 | Soil | MTTERKTPEKIEAARARRSIRIHAFLNRWAARHWPERVTRFPKR |
| Ga0307305_100336651 | 3300028807 | Soil | HKTPTSDDTQTRERRSRRIHAFLGAWAKRHWPERVTRFAKR |
| Ga0307289_101909212 | 3300028875 | Soil | DAQHKTPTSDDTQTRERRSRRIHAFLGAWAKRHWPERVTRFAKR |
| Ga0307277_100020393 | 3300028881 | Soil | MNADRKKPATENDAARARRSRRIQAFLHRWALRHMPERVTRFSR |
| Ga0326597_109984852 | 3300031965 | Soil | MTAQRKTTNARIEEARARRSVRIHAFLSRWAQRHWPERVTRFPKR |
| Ga0364934_0066710_992_1129 | 3300034178 | Sediment | MTTQRKMMESTIEEARARRSIRIHAFLNRWAQRHWPERVTRFPKR |
| ⦗Top⦘ |