| Basic Information | |
|---|---|
| Family ID | F091476 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 38 residues |
| Representative Sequence | RLCHLGNKFQEVLQITKLLTVFDVSNTEAEAVASFSK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.981 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.729 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF06245 | DUF1015 | 35.51 |
| PF13376 | OmdA | 14.02 |
| PF08922 | DUF1905 | 3.74 |
| PF00072 | Response_reg | 1.87 |
| PF01740 | STAS | 1.87 |
| PF07689 | KaiB | 0.93 |
| PF01841 | Transglut_core | 0.93 |
| PF13537 | GATase_7 | 0.93 |
| PF12867 | DinB_2 | 0.93 |
| PF00069 | Pkinase | 0.93 |
| PF02092 | tRNA_synt_2f | 0.93 |
| PF12762 | DDE_Tnp_IS1595 | 0.93 |
| PF07676 | PD40 | 0.93 |
| PF00498 | FHA | 0.93 |
| PF13560 | HTH_31 | 0.93 |
| PF00268 | Ribonuc_red_sm | 0.93 |
| PF00239 | Resolvase | 0.93 |
| PF00392 | GntR | 0.93 |
| PF01842 | ACT | 0.93 |
| PF04191 | PEMT | 0.93 |
| PF01435 | Peptidase_M48 | 0.93 |
| PF13307 | Helicase_C_2 | 0.93 |
| PF13087 | AAA_12 | 0.93 |
| PF07228 | SpoIIE | 0.93 |
| PF01329 | Pterin_4a | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 35.51 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.74 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.93 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.93 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.98 % |
| Unclassified | root | N/A | 14.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10182071 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300001867|JGI12627J18819_10399921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300002914|JGI25617J43924_10283396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 567 | Open in IMG/M |
| 3300005339|Ga0070660_101460947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300005468|Ga0070707_100406663 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300005526|Ga0073909_10275636 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005538|Ga0070731_10028212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3820 | Open in IMG/M |
| 3300005541|Ga0070733_11097584 | Not Available | 534 | Open in IMG/M |
| 3300005553|Ga0066695_10529054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300005598|Ga0066706_10020311 | All Organisms → cellular organisms → Bacteria | 4010 | Open in IMG/M |
| 3300005610|Ga0070763_10823905 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005764|Ga0066903_102065524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1096 | Open in IMG/M |
| 3300005764|Ga0066903_104950219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 707 | Open in IMG/M |
| 3300006162|Ga0075030_100216931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1538 | Open in IMG/M |
| 3300006881|Ga0068865_101086320 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009038|Ga0099829_10009538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 6225 | Open in IMG/M |
| 3300009088|Ga0099830_11325484 | Not Available | 598 | Open in IMG/M |
| 3300009088|Ga0099830_11602173 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009089|Ga0099828_10167266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1951 | Open in IMG/M |
| 3300009089|Ga0099828_10261054 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300009549|Ga0116137_1094876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300009617|Ga0116123_1042158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300009839|Ga0116223_10328467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300010339|Ga0074046_10030248 | All Organisms → cellular organisms → Bacteria | 3701 | Open in IMG/M |
| 3300010341|Ga0074045_11011036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010358|Ga0126370_12182171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300010360|Ga0126372_12946708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300011270|Ga0137391_10675539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300011270|Ga0137391_11118498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300011271|Ga0137393_10093679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2439 | Open in IMG/M |
| 3300011271|Ga0137393_10147353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1962 | Open in IMG/M |
| 3300011271|Ga0137393_10261913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300011271|Ga0137393_10457224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300011271|Ga0137393_10502182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 1041 | Open in IMG/M |
| 3300012096|Ga0137389_10241504 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300012096|Ga0137389_10294119 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300012096|Ga0137389_11674474 | Not Available | 532 | Open in IMG/M |
| 3300012189|Ga0137388_10066666 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
| 3300012189|Ga0137388_10315827 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300012202|Ga0137363_10236462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1480 | Open in IMG/M |
| 3300012202|Ga0137363_11059166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300012202|Ga0137363_11223780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300012203|Ga0137399_10119275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2070 | Open in IMG/M |
| 3300012205|Ga0137362_10369219 | Not Available | 1243 | Open in IMG/M |
| 3300012210|Ga0137378_10220931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1764 | Open in IMG/M |
| 3300012357|Ga0137384_10173136 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300012917|Ga0137395_11287037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012925|Ga0137419_10947818 | Not Available | 711 | Open in IMG/M |
| 3300012925|Ga0137419_11838957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012927|Ga0137416_10213528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1556 | Open in IMG/M |
| 3300012929|Ga0137404_10239751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1552 | Open in IMG/M |
| 3300012929|Ga0137404_11871836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012930|Ga0137407_11279801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300012989|Ga0164305_11818238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300013296|Ga0157374_10363137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300015245|Ga0137409_10346318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
| 3300016270|Ga0182036_11023918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300016319|Ga0182033_10902813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300016357|Ga0182032_11644851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300016371|Ga0182034_11036695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300016371|Ga0182034_12044900 | Not Available | 506 | Open in IMG/M |
| 3300016445|Ga0182038_10527413 | Not Available | 1011 | Open in IMG/M |
| 3300017933|Ga0187801_10045826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1577 | Open in IMG/M |
| 3300017959|Ga0187779_10015816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4304 | Open in IMG/M |
| 3300018062|Ga0187784_10733316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300018482|Ga0066669_10642799 | Not Available | 933 | Open in IMG/M |
| 3300019788|Ga0182028_1066170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300020579|Ga0210407_10525556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300020579|Ga0210407_11220520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300020580|Ga0210403_10784255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300020581|Ga0210399_10971654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300021168|Ga0210406_11307673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300021170|Ga0210400_10260926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
| 3300021432|Ga0210384_10744930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300021475|Ga0210392_10286394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300024181|Ga0247693_1058603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300025472|Ga0208692_1059117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300025932|Ga0207690_10272173 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300026313|Ga0209761_1278866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300026475|Ga0257147_1016942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 1002 | Open in IMG/M |
| 3300026514|Ga0257168_1111467 | Not Available | 609 | Open in IMG/M |
| 3300026523|Ga0209808_1078717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1425 | Open in IMG/M |
| 3300026529|Ga0209806_1296286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300026538|Ga0209056_10583722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300026551|Ga0209648_10173327 | Not Available | 1678 | Open in IMG/M |
| 3300026551|Ga0209648_10448717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300027625|Ga0208044_1173460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027775|Ga0209177_10233172 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027825|Ga0209039_10007081 | All Organisms → cellular organisms → Bacteria | 7249 | Open in IMG/M |
| 3300027846|Ga0209180_10203546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300027911|Ga0209698_11292455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300028536|Ga0137415_10670190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300031057|Ga0170834_105564449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031708|Ga0310686_107011290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031720|Ga0307469_12091494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300031753|Ga0307477_10107636 | Not Available | 1940 | Open in IMG/M |
| 3300031754|Ga0307475_10012247 | All Organisms → cellular organisms → Bacteria | 5761 | Open in IMG/M |
| 3300031754|Ga0307475_10181786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300031879|Ga0306919_11107342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031890|Ga0306925_10381934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
| 3300031945|Ga0310913_10176863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1485 | Open in IMG/M |
| 3300031962|Ga0307479_11836053 | Not Available | 557 | Open in IMG/M |
| 3300032180|Ga0307471_102149597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300033289|Ga0310914_11703526 | Not Available | 534 | Open in IMG/M |
| 3300033402|Ga0326728_10197953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2031 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101820713 | 3300001593 | Forest Soil | LSNLGTKFQEILQITKLVTVFQVFKTEAAAVASLSK* |
| JGI12627J18819_103999211 | 3300001867 | Forest Soil | NLGTKFQEILQITKLVTVFQVFNTEAAALASFAN* |
| JGI25617J43924_102833961 | 3300002914 | Grasslands Soil | ATLMLSNLGRKFNELLQLTKIVTVFEVCNTEAAAVASFSK* |
| Ga0070660_1014609471 | 3300005339 | Corn Rhizosphere | LCHLGSKFQEVLQITKLLTVFEVYDTEAAAVASFSKGAGA* |
| Ga0070708_1004615072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAKTQGASLKLCHLGGKFQEILQLTKLTMVFHVSTTEAVALASFSKPPDEPPI* |
| Ga0070707_1004066634 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SHHTAKKEGASLRLCHLDNKFQQVLQITKLLTVLYISNTEAEAVASLSN* |
| Ga0073909_102756362 | 3300005526 | Surface Soil | AMRLCNLGRKFSKVLQLTKLTTVFQVYGTEAAAVASFSE* |
| Ga0070731_100282126 | 3300005538 | Surface Soil | HLDNKFQQVLQITKLMTLLGISNTEAEAVASFSS* |
| Ga0070733_110975841 | 3300005541 | Surface Soil | KFQEVLQITKLLTVFDVYDTEAQAVSSFSKSAGA* |
| Ga0066695_105290542 | 3300005553 | Soil | LCHLGSKLQEVLQITRLSTVFCVCNTEAVAVASFSV* |
| Ga0066706_100203111 | 3300005598 | Soil | GSKFQEVLQITKLLTVFDVYKTEAEAVASFSKGAGA* |
| Ga0070763_108239052 | 3300005610 | Soil | TTAKSGGASLRLCHLGSKFNELLYITRLITVFDVSNTQADAVRSFTS* |
| Ga0066903_1020655242 | 3300005764 | Tropical Forest Soil | AKKEGASMRLCHLSTRFKELLQIVKLLTFFEVFDTEAAAVASFSK* |
| Ga0066903_1049502192 | 3300005764 | Tropical Forest Soil | LCHLGSKFQEVLQITKLLTVFDVSNTEAEAVAALSQ* |
| Ga0075030_1002169312 | 3300006162 | Watersheds | LCHLGTKFTEVLQITKLMTIFDVYNTEAEAVSSFSK* |
| Ga0068865_1010863201 | 3300006881 | Miscanthus Rhizosphere | CHLGSKFQEVLQITKLLTVFEVFDTEAAAVASFSQ* |
| Ga0099829_100095381 | 3300009038 | Vadose Zone Soil | KFQEVLQITKLLTVFDVYNSEAEAVSSFSKGAGA* |
| Ga0099830_113254842 | 3300009088 | Vadose Zone Soil | HLGSKFQEVLQITKLLTVFEVCDTEAAAVASFSN* |
| Ga0099830_116021732 | 3300009088 | Vadose Zone Soil | SNLERKFQEILQITKLVTVFQVFNTEAAAVASFSR* |
| Ga0099828_101672661 | 3300009089 | Vadose Zone Soil | GSKFQEVLQITKLLTVFDVFNSEAEAVASFSKGAGA* |
| Ga0099828_102610544 | 3300009089 | Vadose Zone Soil | HLGSKFQEVLQITKLLTVFDVFNTEAEAVASFSK* |
| Ga0116137_10948762 | 3300009549 | Peatland | RLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK* |
| Ga0116123_10421582 | 3300009617 | Peatland | ASLRLCHLGSKFQEVMQITKLLTVFEVCDTEAAAVASFSK* |
| Ga0116223_103284671 | 3300009839 | Peatlands Soil | RLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFAK* |
| Ga0074046_100302485 | 3300010339 | Bog Forest Soil | ASLRLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK* |
| Ga0074045_110110362 | 3300010341 | Bog Forest Soil | CHLGTKFQEVLQITKLMTIFDVYNTEAEAVGSFSK* |
| Ga0126370_121821711 | 3300010358 | Tropical Forest Soil | CHLGSKFQEVLQITKLLTVFEVFDTEAAAVASFSK* |
| Ga0126372_129467081 | 3300010360 | Tropical Forest Soil | LCHLGSKFQEVLQITKLLTVFEVFDTEAAAVASFSK* |
| Ga0137391_106755392 | 3300011270 | Vadose Zone Soil | LCHLGNKFQEVLQITKLLTVFDVSNTEAEAVASFST* |
| Ga0137391_111184982 | 3300011270 | Vadose Zone Soil | SLRLCHLGNKFQEVLQITKLLTVFDVSNTEAEAVASFSK* |
| Ga0137393_100936793 | 3300011271 | Vadose Zone Soil | RLCHLGNKFQEVLQITKLLTVFDVSNTEAEAVASFSK* |
| Ga0137393_101473531 | 3300011271 | Vadose Zone Soil | CHLGSKFQEVLQITKLLTVFEVCDTEAAAVASFSN* |
| Ga0137393_102619132 | 3300011271 | Vadose Zone Soil | ASLRLCHLGNKFQEVLQITKLLTVFDVSNTEAEAVASFSK* |
| Ga0137393_104572241 | 3300011271 | Vadose Zone Soil | KFQEVLQITKLLTVFDVYNSEAEAVASFSKGAGA* |
| Ga0137393_105021821 | 3300011271 | Vadose Zone Soil | RLCHLGSKFQEVLQITKLVTVFEVRDTEAAAVASFSN* |
| Ga0137389_102415042 | 3300012096 | Vadose Zone Soil | CHLGSKFQEVLQITKLLTVFEVCDTEAAAFASFSK* |
| Ga0137389_102941191 | 3300012096 | Vadose Zone Soil | HLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFAK* |
| Ga0137389_116744741 | 3300012096 | Vadose Zone Soil | KFQEVLQITKLLTVFDVYNTEAEAVGSFSKGAGA* |
| Ga0137388_100666665 | 3300012189 | Vadose Zone Soil | ALRLCHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFAK* |
| Ga0137388_103158273 | 3300012189 | Vadose Zone Soil | AALRLCHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFAK* |
| Ga0137363_102364621 | 3300012202 | Vadose Zone Soil | ASLRLCHLGSKFQEVLQITKLLTVFEVCETEAAAVASFSN* |
| Ga0137363_110591662 | 3300012202 | Vadose Zone Soil | ASLRLCHLGSKFQEVLQITKLLTVFEVCDTEAAALASFSN* |
| Ga0137363_112237801 | 3300012202 | Vadose Zone Soil | LCHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFTK* |
| Ga0137399_101192754 | 3300012203 | Vadose Zone Soil | GSKFQEVLQITKLLTVFDVYKTEAEAVASFAKGAGV* |
| Ga0137362_103692191 | 3300012205 | Vadose Zone Soil | GSKFQEVLQITKLLTVFDVYNTEAEAVGSFSKGAGA* |
| Ga0137378_102209315 | 3300012210 | Vadose Zone Soil | SLRLCHLGSKFQEVLQITKLLTVFDVFNTEAEAVASFSKGAGA* |
| Ga0137384_101731363 | 3300012357 | Vadose Zone Soil | HLGSKFQEVLQITKLLTVFDVSNTEAEAVASFSQ* |
| Ga0137395_112870371 | 3300012917 | Vadose Zone Soil | LRLCHLGNKFQEVLQITKLLTVFDVSNTEAEAVASFSK* |
| Ga0137419_109478182 | 3300012925 | Vadose Zone Soil | GASLILSNLGTKFQEILQITKLVTVFQVFNTEAAAVASFSK* |
| Ga0137419_118389572 | 3300012925 | Vadose Zone Soil | GSKFQEVLQMTKMLTVFDVYNTEAEAVASFSKGAGA* |
| Ga0137416_102135281 | 3300012927 | Vadose Zone Soil | KFQEVLQITKLLTVFEVFDTEAAAVASFSRGAGA* |
| Ga0137404_102397511 | 3300012929 | Vadose Zone Soil | QGSSLRLCHLGTKFTEVLQITKLMTIFDVYNTEAEAVASFSK* |
| Ga0137404_118718362 | 3300012929 | Vadose Zone Soil | CHLGSKFQEVLQITKLLTVFDVSNTEAEAVASFSQ* |
| Ga0137407_112798011 | 3300012930 | Vadose Zone Soil | HLGSKFQEVLQITKLLTVFDVSDTEAAAVASFSE* |
| Ga0164305_118182381 | 3300012989 | Soil | AALRLCHLGSKFQEVLQITKLLTVFDVSNTEAEAVASFSK* |
| Ga0157374_103631372 | 3300013296 | Miscanthus Rhizosphere | ASLRLCHLGSKFQEVLQITKLLTVFEVYDTEAAAVSSFSQ* |
| Ga0137409_103463181 | 3300015245 | Vadose Zone Soil | ALRLCHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFSK* |
| Ga0182036_110239182 | 3300016270 | Soil | LRLCHLGTKFQEVLQITKLMTIFDVYNTEAEAVASFSKP |
| Ga0182033_109028131 | 3300016319 | Soil | LRLCHIGSKLRELLQITKLLTAFEVFDTEATAVASFSK |
| Ga0182032_116448511 | 3300016357 | Soil | ASLRLCHLGTKFTEVLQITKLMTIFDVYNSEAEAVASFSK |
| Ga0182034_110366951 | 3300016371 | Soil | AKKDGAPLRLCHLGGKSREVLKITKMLTAFEVFDTEAEAVASFSK |
| Ga0182034_120449001 | 3300016371 | Soil | VTSQHTAKKDGAPLHLCHLGSKFREVLQITKLLTAFEVFDTEAAA |
| Ga0182038_105274131 | 3300016445 | Soil | DGAPLRLCHLGCKLRELLQITKLLTAFQVFDTEADAVASFPK |
| Ga0187801_100458261 | 3300017933 | Freshwater Sediment | LCHLGSKFQEVLQITKLLTVFEVFNTEAEAVASFAK |
| Ga0187779_100158164 | 3300017959 | Tropical Peatland | LKLCHLGTKFQEVLQITKLMTIFDVYTTEAEAVGSFSK |
| Ga0187784_107333161 | 3300018062 | Tropical Peatland | KLCHLGTKFQEVLQITKLMTIFDVYNTEAEAVASFLK |
| Ga0066669_106427992 | 3300018482 | Grasslands Soil | LKLCHLGSKLQEVLQITRLSTVFCVCNTEAVAVASFSV |
| Ga0182028_10661702 | 3300019788 | Fen | NQGASLRLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK |
| Ga0210407_105255561 | 3300020579 | Soil | SKFQEVLQITKLLTVFDVYNTEAEAVASFSKGAGV |
| Ga0210407_112205201 | 3300020579 | Soil | RLCHLGSKFQEVLQITKLVTIFEVYDTEAAAVASFSN |
| Ga0210403_107842551 | 3300020580 | Soil | SSLRLCHLGTKFTEVLQITKLMTIFDVYNTEAEAVASFSK |
| Ga0210399_109716542 | 3300020581 | Soil | QGSSLRLCHLGTKFTEVLQITKLMTIFDVYNTEAEAVASFSK |
| Ga0210406_113076732 | 3300021168 | Soil | GSKFQEVLQITKLLTVFDVYNTEAEAVGSFSKGAGA |
| Ga0210400_102609261 | 3300021170 | Soil | GSSLRLCHLGTKFTEVLQITKLMTIFDVYNTEAEAVASFSK |
| Ga0210384_107449301 | 3300021432 | Soil | SKFQEVLQITKLLTVFDVYNSEAEAVSSFSKSAGV |
| Ga0210392_102863942 | 3300021475 | Soil | ASRRLCHLGTKFQEVLQITKLMTIFDVSNTEAEAVASFSKP |
| Ga0247693_10586032 | 3300024181 | Soil | LCHLGSKFQEVLQITKLLTVFEVYDTEAAAVASFSQ |
| Ga0208692_10591171 | 3300025472 | Peatland | RLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK |
| Ga0207690_102721733 | 3300025932 | Corn Rhizosphere | GSKFQEVLQITKLLTVFEVYDTEAAAVASFSKGAGA |
| Ga0209761_12788661 | 3300026313 | Grasslands Soil | GSKFQEVLQITKLLTVFEVYDTETAAVASFSKSSGASH |
| Ga0257147_10169422 | 3300026475 | Soil | QGASLRLCHLGSKFQEVLQITKLLTVFEVCETEAAAVASFSN |
| Ga0257168_11114671 | 3300026514 | Soil | QGASLILSNLGTKFQEILQITKLVTVFQVFNTEAAAVASFSK |
| Ga0209808_10787173 | 3300026523 | Soil | SLGIIKFQEVLQITKLMTVFDVYNTEAEAVASFSK |
| Ga0209806_12962862 | 3300026529 | Soil | CHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFAK |
| Ga0209056_105837221 | 3300026538 | Soil | RLCHLGSKFHEVLQITKLLTVFEVCDTEAAAVASFSN |
| Ga0209648_101733271 | 3300026551 | Grasslands Soil | LSNLGRKFQEVLQITKLLTVFEVCDTEAAAVASFSN |
| Ga0209648_104487173 | 3300026551 | Grasslands Soil | ASLRLCHLGSKFQEVLQITKLLTVFEVCDTEAAAVASFSN |
| Ga0208044_11734601 | 3300027625 | Peatlands Soil | ASLRLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK |
| Ga0209076_10864042 | 3300027643 | Vadose Zone Soil | NAKLQGASLILSNLGTKFQEILQITKLVTVFQVFNTEAAAVASFSK |
| Ga0209177_102331722 | 3300027775 | Agricultural Soil | SKFQEVLQITKLMTVFDVYNTEAEAVASFSKSAGA |
| Ga0209039_100070811 | 3300027825 | Bog Forest Soil | CHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK |
| Ga0209180_102035461 | 3300027846 | Vadose Zone Soil | TVSKFQEVLQITKLLTVFDVYNTEAEAVASFSKGAGV |
| Ga0209698_112924551 | 3300027911 | Watersheds | LCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK |
| Ga0137415_106701902 | 3300028536 | Vadose Zone Soil | ALRLCHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFAK |
| Ga0170834_1055644492 | 3300031057 | Forest Soil | ASLRLCHLGAKFQEVLQITKLLTVFDVSNTEAEAVASFSK |
| Ga0310686_1070112901 | 3300031708 | Soil | LCHLGTKFNELLQLTRLITIFEVYNTQEEAIKSFSN |
| Ga0307469_120914942 | 3300031720 | Hardwood Forest Soil | LCHLGSKFQEVLQITKLLTVFDVFNTEAEAVRSFAK |
| Ga0307477_101076361 | 3300031753 | Hardwood Forest Soil | CHLGRKFREVLQMTKLTTVFQVCNTEAAAVASFSQ |
| Ga0307475_100122471 | 3300031754 | Hardwood Forest Soil | SLRLCHLGTKFTEVLQITKLMTIFDVYNTEAEAVASFSK |
| Ga0307475_101817861 | 3300031754 | Hardwood Forest Soil | CHLGSKFQEVLQITKLLTVFDVFNTEAEAVASFRK |
| Ga0306919_111073422 | 3300031879 | Soil | KLCHLGTKFQEVLQITKLMTIFDVYNTEAEAVASFSK |
| Ga0306925_103819341 | 3300031890 | Soil | LCHLGSKFQEVLQITKLLTVFEVFDTEAAAVASFSK |
| Ga0310913_101768633 | 3300031945 | Soil | HTAKKDGAPLHLCHLGSKFREVLQITKLLTAFEVFDTEAAAVASFSK |
| Ga0307479_118360531 | 3300031962 | Hardwood Forest Soil | SHHTAKKESASLRLCHLDNKSQQLLQITKWLTVLYISNTEAEAVASFSK |
| Ga0307471_1021495971 | 3300032180 | Hardwood Forest Soil | RLCHLGSKFQEVLQITKLLTVFDVFNTEAEAVSSFAK |
| Ga0310914_117035261 | 3300033289 | Soil | VTSHHTAKKEGASMRLCHLSTTFKALLKITKQLTVFEVFDTEAAAVASFSK |
| Ga0326728_101979531 | 3300033402 | Peat Soil | LRLCHLGAKFTEVLQITKLMTIFDVSNTEAEAVASFSK |
| ⦗Top⦘ |