Basic Information | |
---|---|
Family ID | F091475 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 42 residues |
Representative Sequence | LWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVP |
Number of Associated Samples | 60 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.87 % |
% of genes near scaffold ends (potentially truncated) | 99.07 % |
% of genes from short scaffolds (< 2000 bps) | 100.00 % |
Associated GOLD sequencing projects | 59 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (87.850 % of family members) |
Environment Ontology (ENVO) | Unclassified (88.785 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (87.850 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.34% β-sheet: 0.00% Coil/Unstructured: 53.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 87.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 8.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0065712_104129941 | 3300005290 | Miscanthus Rhizosphere | MDQLWYSKFFKFTYKIWSNFEMIQIFKCTPNLNFKMEAEFENVS* |
Ga0068869_1015754261 | 3300005334 | Miscanthus Rhizosphere | VTKSKVEAFYKDQLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENI |
Ga0068867_1010251081 | 3300005459 | Miscanthus Rhizosphere | FYKDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEVEFENVP* |
Ga0068866_105470302 | 3300005718 | Miscanthus Rhizosphere | YVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMESEFENVP* |
Ga0068866_107365732 | 3300005718 | Miscanthus Rhizosphere | YSKFFKFTYKIWSNFEMIQIFKCTPNLNFKMEAEFEIVS* |
Ga0068866_109469981 | 3300005718 | Miscanthus Rhizosphere | WYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVH* |
Ga0068866_113614281 | 3300005718 | Miscanthus Rhizosphere | KFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP* |
Ga0068870_107923521 | 3300005840 | Miscanthus Rhizosphere | DQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP* |
Ga0068865_1014518742 | 3300006881 | Miscanthus Rhizosphere | LWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFEDVP* |
Ga0105243_125483221 | 3300009148 | Miscanthus Rhizosphere | KFFKFTYKIWSNFEMIQILKYTPNLKFKMEVEFENIP* |
Ga0157374_118085691 | 3300013296 | Miscanthus Rhizosphere | YTKFLKFTYIIRSNFEMIQMFKCTPNSNFKMEAEFENVH* |
Ga0157377_102097031 | 3300014745 | Miscanthus Rhizosphere | DQLWYSKFFKFTYKIWSNFEMIQIFKCTPNLNFKMEAEFENVS* |
Ga0182122_10453261 | 3300015267 | Miscanthus Phyllosphere | YSKFFKFTYKIWINFEMIQMLKCTPNSNFKMEAESENVP* |
Ga0182154_10133571 | 3300015268 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVH* |
Ga0182154_10265921 | 3300015268 | Miscanthus Phyllosphere | LFYKDQLWYSKFFKFTYKIWSNFEMIQILKCIPNSNFKMEAEFENVH* |
Ga0182154_10272381 | 3300015268 | Miscanthus Phyllosphere | QLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMKAEFENVH* |
Ga0182154_10351791 | 3300015268 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENIP* |
Ga0182128_10314962 | 3300015277 | Miscanthus Phyllosphere | SKFFKFTYKVWSNFEMIQMLKCTPNSNFKMEAEFEIIP* |
Ga0182174_10165211 | 3300015279 | Miscanthus Phyllosphere | FKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVH* |
Ga0182174_10238252 | 3300015279 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEIIQMLKCTPNSNFKMEAEFENIS* |
Ga0182174_10470951 | 3300015279 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVP* |
Ga0182174_10664372 | 3300015279 | Miscanthus Phyllosphere | SKFLKFTYKIWSNFEMIQMLKCTPNPNFKMKAEFENVH* |
Ga0182160_10493131 | 3300015281 | Miscanthus Phyllosphere | KFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVHLSKVV* |
Ga0182124_10250612 | 3300015282 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQMLKCTPKSNFKMEAEFENIP* |
Ga0182124_10496383 | 3300015282 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVP* |
Ga0182124_10640681 | 3300015282 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEVEFENVP* |
Ga0182156_10238891 | 3300015283 | Miscanthus Phyllosphere | KFFKFTYKIWSNFEMIQILKCTLNSNFKMEAEFENVH* |
Ga0182156_10264832 | 3300015283 | Miscanthus Phyllosphere | YSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEQEFENVP* |
Ga0182156_10774701 | 3300015283 | Miscanthus Phyllosphere | KFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP* |
Ga0182186_10358751 | 3300015285 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKIEAEFENIP* |
Ga0182186_10565361 | 3300015285 | Miscanthus Phyllosphere | QLWYSKFLKFTYKIWSNFELIQMLKCTPNSNFKIEEEFENVH* |
Ga0182176_10165003 | 3300015286 | Miscanthus Phyllosphere | LFYKDQLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAELENVH* |
Ga0182176_10361101 | 3300015286 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP* |
Ga0182171_10023291 | 3300015287 | Miscanthus Phyllosphere | KDQLWYSKFFKFTYKIWSNFEMIQIFKCTPNVKFKMEAEFENVS* |
Ga0182171_10038311 | 3300015287 | Miscanthus Phyllosphere | RLFYKDQLWYSKFFKFTCKIWSNFEMIQILKCTPNSNFKMEVEFENVP* |
Ga0182173_10549502 | 3300015288 | Miscanthus Phyllosphere | LFYKDQLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEVEFENVHLSKVVEL* |
Ga0182175_10072504 | 3300015295 | Miscanthus Phyllosphere | LWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEVEFENIHLSKVVEL* |
Ga0182175_10450801 | 3300015295 | Miscanthus Phyllosphere | QLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENIP* |
Ga0182175_10905841 | 3300015295 | Miscanthus Phyllosphere | KFTYKNWSNFEMVQMLKCTPNSNFKMEAEIENVP* |
Ga0182157_10111032 | 3300015296 | Miscanthus Phyllosphere | SKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEF* |
Ga0182157_10186382 | 3300015296 | Miscanthus Phyllosphere | VDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFGNVP* |
Ga0182157_10473341 | 3300015296 | Miscanthus Phyllosphere | QLWYSKFFKITYKIWSNFEMIQIFKCTPNLNFKMEVEFENVS* |
Ga0182106_10675681 | 3300015298 | Miscanthus Phyllosphere | LFYVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNLNFKMEAEFENVH* |
Ga0182107_10196343 | 3300015299 | Miscanthus Phyllosphere | FYKDQLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMDVEFENVP* |
Ga0182107_10404601 | 3300015299 | Miscanthus Phyllosphere | QLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKIEAEFENVH* |
Ga0182107_10441451 | 3300015299 | Miscanthus Phyllosphere | FYVDQLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEVEFENVH* |
Ga0182143_10149043 | 3300015302 | Miscanthus Phyllosphere | FYKGQLWYSKFFKFTYKIWSNFEMIKILKCTPNLNFKMEAEFENVP* |
Ga0182143_10332541 | 3300015302 | Miscanthus Phyllosphere | KFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENIS* |
Ga0182158_10346261 | 3300015305 | Miscanthus Phyllosphere | QLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVS* |
Ga0182158_11060731 | 3300015305 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENIP* |
Ga0182144_10261391 | 3300015307 | Miscanthus Phyllosphere | QLWYSKFFKFTYKIWSNFEMIQILKCTLNSNFKIEAEFENVH* |
Ga0182127_10505561 | 3300015321 | Miscanthus Phyllosphere | LWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEVEFENIP* |
Ga0182127_10974111 | 3300015321 | Miscanthus Phyllosphere | FFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVP* |
Ga0182129_10377991 | 3300015323 | Miscanthus Phyllosphere | KFFKFTYKIWGNFEIFQMLKCTPNSNFKMEAEFENVP* |
Ga0182187_11560883 | 3300015341 | Miscanthus Phyllosphere | YKDQLWYSKFLKFTYKIWSNFEIIQMLKCTPNSNFKIEAEFENVH* |
Ga0182187_11744632 | 3300015341 | Miscanthus Phyllosphere | LFYKDQLWYLKFLKFTYKIWSNFEMIQMIKCTPNSNFKMEAEFENVY* |
Ga0182109_10703871 | 3300015342 | Miscanthus Phyllosphere | FYKDQLWYSKFLKFTYKIWSNFEMIQILKCTPNSNFKMEEGFENVH* |
Ga0182109_10795781 | 3300015342 | Miscanthus Phyllosphere | RLFYKDQLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMGAEFQNVP* |
Ga0182109_10972411 | 3300015342 | Miscanthus Phyllosphere | SKFLKFTYKIWSNFEMIQMLKCILNSNFKMEAEFENVPIRKVVEL* |
Ga0182155_10420122 | 3300015343 | Miscanthus Phyllosphere | FLKFTYKIWSNFEMIQMLKCTPNSNFKMKAEFENVH* |
Ga0182155_10740531 | 3300015343 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENIS* |
Ga0182155_11635351 | 3300015343 | Miscanthus Phyllosphere | KDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMGAEFENVP* |
Ga0182189_11113022 | 3300015344 | Miscanthus Phyllosphere | LFYVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAKFENVH* |
Ga0182189_11614932 | 3300015344 | Miscanthus Phyllosphere | LFYKDQLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEVEFENVH* |
Ga0182111_10767601 | 3300015345 | Miscanthus Phyllosphere | SKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEVEFENIH* |
Ga0182111_10860282 | 3300015345 | Miscanthus Phyllosphere | FLKFTYKVWSNFEMIQMLKCTPNSNFKMKAEFENIP* |
Ga0182139_11324401 | 3300015346 | Miscanthus Phyllosphere | IFYKDQLWYSKFFKFTYKIWSNFEMVQMLKCTPNSNFKMEVEFENVP* |
Ga0182139_11562251 | 3300015346 | Miscanthus Phyllosphere | SKFFKFTCKIWSNFEMIQMLKCTPNSNFKMEAEFENVP* |
Ga0182139_11751501 | 3300015346 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEIIQMLKCTPNSNFKMEAEFENVY* |
Ga0182139_12250031 | 3300015346 | Miscanthus Phyllosphere | LWYSKFLKFTNKIWGNFEMIQMLKCTPNSNFKIEAEFENVH* |
Ga0182177_11530661 | 3300015347 | Miscanthus Phyllosphere | SLSYEDQLWYTKFLKFTYKVWSNFEMIQIFKCTPNLNFEMEAEFENVS* |
Ga0182161_12574501 | 3300015351 | Miscanthus Phyllosphere | YVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP* |
Ga0182159_11602392 | 3300015355 | Miscanthus Phyllosphere | NKDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMGAEFENVP* |
Ga0182145_10522682 | 3300015361 | Miscanthus Phyllosphere | WYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVH* |
Ga0182145_11201961 | 3300015361 | Miscanthus Phyllosphere | KFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFEIFLEAKL* |
Ga0182203_10706461 | 3300017404 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVH |
Ga0182204_10867101 | 3300017409 | Miscanthus Phyllosphere | FLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVH |
Ga0182204_10989992 | 3300017409 | Miscanthus Phyllosphere | LFYKDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEVEFENIP |
Ga0182222_10255531 | 3300017413 | Miscanthus Phyllosphere | KFLKFTYKVWSNFEMIQIFKCTPNLNFEMEAEFENVS |
Ga0182222_10574591 | 3300017413 | Miscanthus Phyllosphere | LWYSKFFKFTYKIWSNFEMIQIFKCTPNVKFKMEAEFENVS |
Ga0182202_10665751 | 3300017415 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKIEAEFENVH |
Ga0182219_10393461 | 3300017424 | Miscanthus Phyllosphere | SWRVFYKDQLWYSKFFKFTYKIWSNFEMIQIFKCTPNVKFKMEAEFENVS |
Ga0182219_11187331 | 3300017424 | Miscanthus Phyllosphere | LFYVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP |
Ga0182224_11524481 | 3300017425 | Miscanthus Phyllosphere | KFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAGFENIH |
Ga0182190_11008651 | 3300017427 | Miscanthus Phyllosphere | LFYKDQLWYSKFFKFTYKIWSNFEMIQMLKCTPNSNFKMEPEFENVH |
Ga0182190_11151531 | 3300017427 | Miscanthus Phyllosphere | DQLWYSKFFKFTYKIWSNFEMIQIFKCTPNLNFKMEAEFEIVS |
Ga0182192_11133481 | 3300017430 | Miscanthus Phyllosphere | LWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEPEFENVH |
Ga0182206_10846751 | 3300017433 | Miscanthus Phyllosphere | QSWSLFYKDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVP |
Ga0182206_11360551 | 3300017433 | Miscanthus Phyllosphere | KFFKFTYKIWSNFEMIQILKCTPNSNFNMGAEFENVP |
Ga0182209_10300852 | 3300017436 | Miscanthus Phyllosphere | FLKFTYKVWSNFEMIQMLKCTPNSNFKMEAEFENIP |
Ga0182191_10796102 | 3300017438 | Miscanthus Phyllosphere | IFYKDQLWYSKFFEFTYKIWSNFEMVQMLKCTPNSNFKMQVEFENVP |
Ga0182221_10450002 | 3300017442 | Miscanthus Phyllosphere | KDQLWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENIP |
Ga0182193_10774752 | 3300017443 | Miscanthus Phyllosphere | YKDQLWYSKFLKFKYKVWSNFEMIQMLKCTLNSNFKMEAEFENIP |
Ga0182226_10604311 | 3300017681 | Miscanthus Phyllosphere | SKFLKFTHKIWSNFEMIQMLKCTPNSNFKMEAEFENVH |
Ga0182226_11212031 | 3300017681 | Miscanthus Phyllosphere | KYFKITYKIWSNFEMIQIFKCTPNLNFKMEAEFEIVS |
Ga0182229_10341011 | 3300017682 | Miscanthus Phyllosphere | TQFLKFTYKVWNNFEMIQIFKCTPNLNFEMEAEFENVS |
Ga0182218_10893912 | 3300017683 | Miscanthus Phyllosphere | LFYKDQLWYSKFFKFTYKIWSNFEMIQMLKCTPNLNFKMEVEFENVP |
Ga0182218_10995021 | 3300017683 | Miscanthus Phyllosphere | KFSKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVYLSKVVEL |
Ga0182225_10309562 | 3300017684 | Miscanthus Phyllosphere | KFLKFTYKIWSNFEMIQMLKCTPNSNFKMEAEFENVP |
Ga0182225_10446841 | 3300017684 | Miscanthus Phyllosphere | LFYVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEVEFENVP |
Ga0182227_10146412 | 3300017685 | Miscanthus Phyllosphere | SKFFKFTYKIWSNFEMIQIFKCTPNVKFKMEAEFENVS |
Ga0182227_10716102 | 3300017685 | Miscanthus Phyllosphere | WYSKFLKFTYKVWSNFEMIQMLKCTPNSNFKMEAEFENIP |
Ga0182227_10860761 | 3300017685 | Miscanthus Phyllosphere | RLFYVDQLWYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMGAEFENVP |
Ga0182227_10982771 | 3300017685 | Miscanthus Phyllosphere | KFFKFTYKIWSNFEMIQMLKCTPNSNFKIEVEFENVH |
Ga0182205_11368682 | 3300017686 | Miscanthus Phyllosphere | FKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVH |
Ga0182223_10956571 | 3300017690 | Miscanthus Phyllosphere | LWYSKFLKFTYKIWSNFEMIQMLKCTPNSNFKMEPEFENVP |
Ga0207642_107259091 | 3300025899 | Miscanthus Rhizosphere | WYSKFFKFTYKIWSNFEMIQILKCTPNSNFKMEAEFENVH |
⦗Top⦘ |