Metagenome Family F091458

Overview

Basic Information

• Family ID: F091458
• Family Type: Metagenome
• Number of Sequences: 107
• Average Sequence Length: 43 residues
• Representative Sequence: LRLIEAWLGIQQSIADQAIDEWRVHLNACVKAKGKHIENML
• Number of Associated Samples: 21
• Number of Associated Scaffolds: 107

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 21.70 %
• % of genes near scaffold ends (potentially truncated): 35.51 %
• % of genes from short scaffolds (< 2000 bps): 59.81 %
• Associated GOLD sequencing projects: 16
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (62.617 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (85.981 % of family members)
• Environment Ontology (ENVO): Unclassified (98.131 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (97.196 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 56.52%
  β-sheet: 0.00%
  Coil/Unstructured: 43.48%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF07885	Ion_trans_2	2.80
PF13246	Cation_ATPase	1.87
PF07714	PK_Tyr_Ser-Thr	0.93
PF16516	CC2-LZ	0.93
PF00211	Guanylate_cyc	0.93
PF03144	GTP_EFTU_D2	0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.74
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.93

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
All Organisms	root	All Organisms	37.38 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
cellular organisms	root	All Organisms → cellular organisms	36.45 %
Viruses	superkingdom	All Organisms → Viruses	0.93 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	35.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.93 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	32.71 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	20.56 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	20.56 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	20.56 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	12.15 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	8.41 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	8.41 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	6.54 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	5.61 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	8.41 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	6.54 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	5.61 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	8.41 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	6.54 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	4.67 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	0.93 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	8.41 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	6.54 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Bivalvia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia	0.93 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	8.41 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	6.54 %
Autobranchia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia	0.93 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	8.41 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	6.54 %
Pteriomorphia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia	0.93 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	8.41 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	6.54 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.93 %
Mytiloida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Cladistia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia	8.41 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	6.54 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.93 %
Mytiloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypteriformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes	8.41 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	6.54 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Mytilidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypteridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae	8.41 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	6.54 %
Mytilinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus	8.41 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.62 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	8.41 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	6.54 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.93 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.93 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300003817|Ga0056122_10018753	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1271
3300003817|Ga0056122_10054599	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	934
3300003817|Ga0056122_10171220	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	638
3300004626|Ga0066188_1026595	Not Available	1658
3300004626|Ga0066188_1071574	Not Available	1174
3300004626|Ga0066188_1188324	Not Available	735
3300004632|Ga0049107_10065443	Not Available	2522
3300004632|Ga0049107_10455564	All Organisms → cellular organisms → Eukaryota → Opisthokonta	696
3300005649|Ga0056116_1009851	Not Available	5146
3300005649|Ga0056116_1020420	Not Available	3922
3300005649|Ga0056116_1029923	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	3335
3300005649|Ga0056116_1056488	Not Available	2427
3300005968|Ga0056130_1014394	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3114
3300005968|Ga0056130_1022757	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2682
3300005968|Ga0056130_1034374	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2305
3300005968|Ga0056130_1036656	Not Available	2248
3300005968|Ga0056130_1042306	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2118
3300005968|Ga0056130_1044536	All Organisms → cellular organisms → Eukaryota	2072
3300005968|Ga0056130_1045099	Not Available	2060
3300005968|Ga0056130_1056110	Not Available	1872
3300005968|Ga0056130_1076814	Not Available	1605
3300005968|Ga0056130_1091245	Not Available	1464
3300005968|Ga0056130_1098791	Not Available	1399
3300005968|Ga0056130_1115295	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1273
3300005968|Ga0056130_1132849	Not Available	1162
3300005968|Ga0056130_1151755	Not Available	1060
3300005968|Ga0056130_1161073	Not Available	1015
3300005968|Ga0056130_1186147	Not Available	906
3300005968|Ga0056130_1206275	Not Available	831
3300005968|Ga0056130_1234351	Not Available	741
3300005968|Ga0056130_1334519	Not Available	515
3300005978|Ga0056129_1013954	Not Available	4311
3300005978|Ga0056129_1026606	Not Available	3363
3300005978|Ga0056129_1043930	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2686
3300005978|Ga0056129_1061867	Not Available	2244
3300005978|Ga0056129_1065168	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2176
3300005978|Ga0056129_1075817	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1988
3300005978|Ga0056129_1085246	Not Available	1845
3300005978|Ga0056129_1104907	Not Available	1598
3300005978|Ga0056129_1119820	Not Available	1446
3300005978|Ga0056129_1134745	All Organisms → cellular organisms → Eukaryota	1314
3300005978|Ga0056129_1156527	Not Available	1154
3300005978|Ga0056129_1165458	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1096
3300005978|Ga0056129_1172823	Not Available	1051
3300005978|Ga0056129_1190839	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	952
3300005978|Ga0056129_1215418	Not Available	837
3300005978|Ga0056129_1292917	Not Available	580
3300005978|Ga0056129_1315878	Not Available	528
3300005978|Ga0056129_1321855	Not Available	516
3300006912|Ga0056114_1015182	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5377
3300006912|Ga0056114_1015644	Not Available	5312
3300006912|Ga0056114_1017745	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5055
3300006912|Ga0056114_1019916	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4815
3300006912|Ga0056114_1031115	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	3911
3300006912|Ga0056114_1035806	Not Available	3636
3300006912|Ga0056114_1043067	Not Available	3287
3300006912|Ga0056114_1043842	Not Available	3253
3300006912|Ga0056114_1045948	Not Available	3168
3300006912|Ga0056114_1054071	Not Available	2867
3300006912|Ga0056114_1064911	All Organisms → cellular organisms → Eukaryota	2535
3300006912|Ga0056114_1076166	Not Available	2258
3300006912|Ga0056114_1085368	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	2063
3300006912|Ga0056114_1090187	Not Available	1972
3300006912|Ga0056114_1102178	Not Available	1767
3300006912|Ga0056114_1118094	Not Available	1539
3300006912|Ga0056114_1131818	Not Available	1375
3300006912|Ga0056114_1169506	Not Available	1027
3300006912|Ga0056114_1233333	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	672
3300006912|Ga0056114_1251295	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	608
3300006913|Ga0056115_1068089	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	2260
3300006913|Ga0056115_1074323	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2130
3300006913|Ga0056115_1186589	Not Available	980
3300010043|Ga0126380_11633779	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	576
3300010295|Ga0126334_10079599	Not Available	1807
3300010298|Ga0126325_10176021	Not Available	1106
3300010298|Ga0126325_10304319	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	733
3300010315|Ga0136654_1035217	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	2564
3300010315|Ga0136654_1383220	Not Available	509
3300012273|Ga0126329_10108291	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1482
3300020581|Ga0210399_11156409	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	617
3300027289|Ga0209787_1012508	Not Available	2697
3300027289|Ga0209787_1026711	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2111
3300027289|Ga0209787_1028592	Not Available	2060
3300027289|Ga0209787_1068867	All Organisms → Viruses → Predicted Viral	1430
3300027289|Ga0209787_1079648	Not Available	1328
3300027289|Ga0209787_1090678	Not Available	1239
3300027289|Ga0209787_1106483	Not Available	1132
3300027289|Ga0209787_1176917	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	805
3300027289|Ga0209787_1207191	Not Available	701
3300027289|Ga0209787_1235228	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	623
3300027289|Ga0209787_1287717	Not Available	500
3300027392|Ga0209680_1030215	Not Available	2986
3300027392|Ga0209680_1068162	Not Available	1989
3300027392|Ga0209680_1069487	Not Available	1966
3300027392|Ga0209680_1095048	Not Available	1612
3300027392|Ga0209680_1128161	Not Available	1276
3300027392|Ga0209680_1136711	Not Available	1207
3300027392|Ga0209680_1217755	Not Available	734
3300027544|Ga0209568_1006801	Not Available	5680
3300027544|Ga0209568_1008830	Not Available	5201
3300027544|Ga0209568_1028199	Not Available	3345
3300027544|Ga0209568_1056992	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	2394
3300027557|Ga0209679_1060007	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	2794
3300027557|Ga0209679_1110780	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1861
3300027615|Ga0209678_1315670	Not Available	697
3300031469|Ga0170819_16901943	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	670

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.20%
Environmental	Environmental	2.80%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	97.20%
Terrestrial	Environmental → Terrestrial	2.80%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	97.20%
Soil	Environmental → Terrestrial → Soil	2.80%

Type

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	85.98%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	11.21%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.80%

Subtype

Habitat	Taxonomy	Distribution
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	85.98%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	11.21%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.87%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	0.93%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	85.98%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	5.61%
Marine Gutless Worms	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms	5.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300003817	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND	Host-Associated
3300004144	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1 (version 2)	Host-Associated
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300004632	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1	Host-Associated
3300005649	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300006913	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.1	Host-Associated
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027544	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2 (SPAdes)	Host-Associated
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated
3300027615	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.1 (SPAdes)	Host-Associated
3300031469	Fir Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0056122_100187531	3300003817	Marine Gutless Worms Symbiont	TPVNDTTDLQRLSEAWSGITQAVFDKAIDQWTVRLRACVKERGRHFEHLL*
Ga0056122_100545991	3300003817	Marine Gutless Worms Symbiont	KQRLIEAWSGITQAVFDKAIDQWTVRLRACVKARGRHFEHLL*
Ga0056122_101712201	3300003817	Marine Gutless Worms Symbiont	RLIEAWSGITQAVFDKAIDQWTVRLRACVKARGRHFEHLL*
Ga0066189_102571811	3300004144	Marine Gutless Worms Symbiont	VPEETIEALSGIQQSITDQANNNQWRKRLNACAKAKGKHFEHLL*
Ga0066188_10265952	3300004626	Marine Gutless Worms Symbiont	MRGYWLGIQQSVTDQAFDQWRACLNASVKAKGKHFEYML*
Ga0066188_10715742	3300004626	Marine Gutless Worms Symbiont	SEICQKLNADELKLRLIEVCFGIQQSVIDQAIDQWRVCLNACVKAKGKHF*
Ga0066188_11883241	3300004626	Marine Gutless Worms Symbiont	LRLIEAWFGIQKSVADQAIDQWRVCLNACVKAKGKHYEHM
Ga0049107_100654435	3300004632	Marine Gutless Worms Symbiont	VDEMKQRLIEEWSGIQQGVIDQGIDQWRDRLNACVKAKSNLEHLL*
Ga0049107_104555642	3300004632	Marine Gutless Worms Symbiont	VPEEMIEAWSGIQWSITDQAISQWRYRLNVSVKAKGKHFEHLL*
Ga0056116_10098517	3300005649	Marine Gutless Worms Symbiont	MGDLQLRLIEAWSAIHQSMIDQAIDLWRVRLNACVDAKGKHFEHML*
Ga0056116_10204203	3300005649	Marine Gutless Worms Symbiont	LEELKLRLIEAWSGIHQSVIDQAIDQWRVRLNAYVNTEGKHFEHML*
Ga0056116_10299232	3300005649	Marine Gutless Worms Symbiont	MRLIEAWSGVHQTVTDQAIGQWRVRLNARVDAKGKHFEHML*
Ga0056116_10564881	3300005649	Marine Gutless Worms Symbiont	VFIESVKDVEKLKLRLIEAWSGIHPSIVDQAIDQWRVCLNAKHFELML*
Ga0056130_10143947	3300005968	Marine Gutless Worms Symbiont	MKRILIEAWLGIQQSIADQAIDKWRVHLNACVKAKGKHFENMLDVLFHNCQ*
Ga0056130_10227576	3300005968	Marine Gutless Worms Symbiont	VFIGNLLKLNADGLKLHLIEASLGILQSVADKATDQWRVHLNASVKAKGKHFEHML*
Ga0056130_10343743	3300005968	Marine Gutless Worms Symbiont	LNVDELKRLLIEAWLGIQQSVADQAIDKWQVHLNACVKAKGNYFENML*
Ga0056130_10366563	3300005968	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQAIDEWQVHLNACVKAKGKHIENML*
Ga0056130_10423061	3300005968	Marine Gutless Worms Symbiont	VWLGIQQSIADQAIDQWRVHLNACVKAKGKHIEIML
Ga0056130_10445365	3300005968	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSVTNQAIDEWRVHLNACVKAKGKHIENML*
Ga0056130_10450994	3300005968	Marine Gutless Worms Symbiont	MLQIQQSVIDQAIDQWRVRLNACVKAKVKDFEYLHNNL*
Ga0056130_10561105	3300005968	Marine Gutless Worms Symbiont	IEAWLGIQQSVADQAIDQWRLHFNACVKAKEKHFENML*
Ga0056130_10768143	3300005968	Marine Gutless Worms Symbiont	LRLIEAWFGIQQSVADQAIDQWPVRAKGKHYENML*
Ga0056130_10912453	3300005968	Marine Gutless Worms Symbiont	LRPIETWFGIQKSVADQAIDQWRVCLNACVKAKGKHYEHML*
Ga0056130_10987912	3300005968	Marine Gutless Worms Symbiont	MIEVWFGIQQGVADQAIGQWRVHLKASVKAKGKHFENML*
Ga0056130_11152952	3300005968	Marine Gutless Worms Symbiont	MLKLNADELKRLLIEAWFGIQQSVADQAIDPWRVHLNACVKAK*
Ga0056130_11328491	3300005968	Marine Gutless Worms Symbiont	LRLIEVWLGIQQNIADQAIDEWQVHLNACVKAKGKHIENML*
Ga0056130_11517551	3300005968	Marine Gutless Worms Symbiont	LKRLLTEAWFGIQQSVADQAIDQWRVHLNACVKAKGKHFENML*
Ga0056130_11610731	3300005968	Marine Gutless Worms Symbiont	LKRLLIEAWLGIQQSIADQAIDQWRVHLNTSVKAKGKHFENML*
Ga0056130_11861473	3300005968	Marine Gutless Worms Symbiont	MRLIEVRFGIQQSVADQAIDQWRVCLNACVKAKGNHYEHML*
Ga0056130_12062752	3300005968	Marine Gutless Worms Symbiont	MNADELKRLFIKVQFGIQQSVVDQATDQWRVCLNACVKAKGKHFEHML*
Ga0056130_12343512	3300005968	Marine Gutless Worms Symbiont	LHLIEAWLGIQQSIADKAIDEWRVHLNACVKAKGKHIEDML*
Ga0056130_13345191	3300005968	Marine Gutless Worms Symbiont	LRLIEAWFGILQSIADQTIDEWRVHFNACVKAKGKRIENML*
Ga0056129_101395412	3300005978	Marine Gutless Worms Symbiont	LKQLLIEVWLGIQQSDADLAIDQWRVCLNACVKAKGK
Ga0056129_10266067	3300005978	Marine Gutless Worms Symbiont	MRLAIQQSVIDQVIDQWRVCFNACVKAKEKHFEHML*
Ga0056129_10439304	3300005978	Marine Gutless Worms Symbiont	LRLIEAWFGIQQSVADQATDKWRVHLNACVKAKGKHIENMLYDVLFHNCQ*
Ga0056129_10618676	3300005978	Marine Gutless Worms Symbiont	VRLIEAWLGIQQSVADQAIDEWRVHLNACVKAKEKHIENML*
Ga0056129_10651682	3300005978	Marine Gutless Worms Symbiont	LRLTEAWLGIQQSIVDQAIDEWRVYLNACVKAKGKHIENML*
Ga0056129_10758171	3300005978	Marine Gutless Worms Symbiont	LHLIEVWFGIQHSIADQAIDEWRVHFNACVKAKGKHIENML*
Ga0056129_10852465	3300005978	Marine Gutless Worms Symbiont	EAWFGIQQSVADQAIDKMAVHLNACVKAKGKHFENML*
Ga0056129_11049073	3300005978	Marine Gutless Worms Symbiont	LRLIETWFGIQKSVADQAIDQWRVCLNACVKAKGKHYEHML*
Ga0056129_11198202	3300005978	Marine Gutless Worms Symbiont	LRLIEAWLGILQSIADQAIDEWRVHLNACIKAKGKHIENML*
Ga0056129_11347451	3300005978	Marine Gutless Worms Symbiont	EAWFGIQQSVADQAIDQWRVHLNACVKAKGKHFENML*
Ga0056129_11565273	3300005978	Marine Gutless Worms Symbiont	LRLIEAWFGIQQSIADQVIDEWRVHFNACVKAKGKHIENML*
Ga0056129_11654582	3300005978	Marine Gutless Worms Symbiont	MLKLNADELKRLLIEAWLGIQQSVADQVIDQWRVHLNACVNAKGKHFENVL*
Ga0056129_11728231	3300005978	Marine Gutless Worms Symbiont	WFGIQQSVADQAIDQWRVHLNACVKAKGKHFENML*
Ga0056129_11908392	3300005978	Marine Gutless Worms Symbiont	LNADELKRLLIEVWLGRQQSAADQAIDQWQVHLNACVKAKGKHFEHML*
Ga0056129_12154182	3300005978	Marine Gutless Worms Symbiont	LRLIEAWLGIQQNIADQAIDEWRVHLNACVKAKGKHIENML*
Ga0056129_12929171	3300005978	Marine Gutless Worms Symbiont	LRLIEVWLGIQQNIADQAIDEWQVHLNACVKAKGKH
Ga0056129_13158781	3300005978	Marine Gutless Worms Symbiont	LRTSLSDLKRRLIETWLGIQQYVIDQAIDQWRVCLNACVKAKGKH
Ga0056129_13218551	3300005978	Marine Gutless Worms Symbiont	LCLIEAWFGIQQSVADQAIDQWRVHLNACVKAKGMPFFLKT*
Ga0056114_10151825	3300006912	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIVDQAIGEWRVYLNACVKAKRKHFENML*
Ga0056114_10156449	3300006912	Marine Gutless Worms Symbiont	LRLIEEWLGIQQSIADPAIDEWQVHLNACVKAKGKHIENML*
Ga0056114_10177459	3300006912	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQAKDEWRVHFNACVKAKGKHTENML*
Ga0056114_10199164	3300006912	Marine Gutless Worms Symbiont	MLRLIEAWLGIQQSIADQAIDEWRVHLNACVKVKEQHFENML*
Ga0056114_10311155	3300006912	Marine Gutless Worms Symbiont	LRLIEAWFGIQQSIADAAIDQWRVHLNASVKAKGKHFENML*
Ga0056114_10358063	3300006912	Marine Gutless Worms Symbiont	MNVDELKRLLIEVWFGIQQSVADQAIDQWRVCLNACVKTKGKHFEHML*
Ga0056114_10430674	3300006912	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQATEQWRVGLNACVKVKGKHFEHTL*
Ga0056114_10438424	3300006912	Marine Gutless Worms Symbiont	VFIGNLFKKQLLIEVWFEMQQSVADQAIDQWRVCLNACVKAKGKHFEHML*
Ga0056114_10459483	3300006912	Marine Gutless Worms Symbiont	LHLIEAWLGIQQSITDQAIDEWRVHLTACVKAKGKHIEDMLCDVLFHNCQ*
Ga0056114_10540711	3300006912	Marine Gutless Worms Symbiont	KLNADELKRLLIEVWFGIQQSVADQAIDQWRVHLNACVKAKGTHFENVL*
Ga0056114_10649118	3300006912	Marine Gutless Worms Symbiont	LRLIEAWFGIQKSVADQAIDQWRVCLNACVKAKGKHYEH
Ga0056114_10761662	3300006912	Marine Gutless Worms Symbiont	VRLIEAWLGIQQSVADQAIDEWRVHLNACVKAKGKHIENML*
Ga0056114_10853681	3300006912	Marine Gutless Worms Symbiont	VFIGNELKWRSIEAWFGNQQSVADQAIDQWRSHLNACVKAKGKHFEHML*
Ga0056114_10901874	3300006912	Marine Gutless Worms Symbiont	LNADELKRLLIEVWFGIQQSVADQATDQWQVHLNACVKAKEKHYENML*
Ga0056114_11021783	3300006912	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQAIEWRVHVNACVKAKGKYFENML*
Ga0056114_11180942	3300006912	Marine Gutless Worms Symbiont	LRLIEAWFGIQQSIADQAIDEWRVHFNACVKAKGKHIENML*
Ga0056114_11318184	3300006912	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQAIDEWRVHLNACVKAKGKHIENM
Ga0056114_11695062	3300006912	Marine Gutless Worms Symbiont	ELKRLLIEAWLGIQQSVADQAIDQWRVLLNACVKAKGKRYENML*
Ga0056114_12333333	3300006912	Marine Gutless Worms Symbiont	RLIEAWFGIQKSVADQAIDQWRVCLNACVKAKGKHYEHML*
Ga0056114_12512951	3300006912	Marine Gutless Worms Symbiont	LRLIEAWLDIQQRIADQAIDVDEWRVHFNACVKAKGKHIENML*
Ga0056115_10680893	3300006913	Marine Gutless Worms Symbiont	MRLIEAWSGVHQTITDQAIGQWRVRLNARVDAKGKHFEHML*
Ga0056115_10743231	3300006913	Marine Gutless Worms Symbiont	VKLRLIEGIHQIIIDQATYQWPVRLNACIDAKGKHFEHML*
Ga0056115_11865892	3300006913	Marine Gutless Worms Symbiont	LKTGNHLKIEAWSGIHQRIVDQATDQRQVRLNACVDAKGKHFEH
Ga0126380_116337791	3300010043	Tropical Forest Soil	LRLIEAWSGVKQSVIDQAIDQWRVRLNACINAKGKHFEYML*
Ga0126334_100795991	3300010295	Marine Gutless Worms	VEELKRRLIEAWLGIQQSVTDQWQIRVNACVKAK*
Ga0126325_101760211	3300010298	Marine Gutless Worms	KRRLIEAWLGIQQSVTDQATDQWQIRVNACVKAKGKHFQHTL*
Ga0126325_103043191	3300010298	Marine Gutless Worms	LLLLLLGIQQSVIDQAIDQWRVRLNACVKAKGKRFEHTL*
Ga0136654_10352173	3300010315	Marine Gutless Worms	CLIEAWLGIQQSVTDQAIDQWRIRLNACVKAKGKHF*
Ga0136654_13832201	3300010315	Marine Gutless Worms	SDLLLLKRRLIEAWLGIQQSVTDQAIDQWRICLNACIKAKGKHFEHTL*
Ga0126329_101082913	3300012273	Marine Gutless Worms	VDELKRRLTEAWLGIQQSVTDQAIDQWRIRLNACVKAKGKDFEHTL*
Ga0210399_111564091	3300020581	Soil	VDELKLRLIEAWSGIQQSIIDHAIDQWRVRLNACIKAKGKHFEHML
Ga0209787_10125081	3300027289	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQAIDEWQVHLNACVKAKGKHIENML
Ga0209787_10267112	3300027289	Marine Gutless Worms Symbiont	VFIGNLLKLNADGLKLHLIEASLGILQSVADKATDQWRVHLNASVKAKGKHFEHML
Ga0209787_10285922	3300027289	Marine Gutless Worms Symbiont	MLQIQQSVIDQAIDQWRVRLNACVKAKVKDFEYLHNNL
Ga0209787_10688671	3300027289	Marine Gutless Worms Symbiont	MIEVWFGIQQGVADQAIGQWRVHLKASVKAKGKHFENML
Ga0209787_10796481	3300027289	Marine Gutless Worms Symbiont	LNVDELKRLLIEAWLGIQQSVADQAIDKWQVHLNACVKAKGNYFENML
Ga0209787_10906781	3300027289	Marine Gutless Worms Symbiont	LRLIEAWFGIQQSVADQAIDQWPVRAKGKHYENML
Ga0209787_11064831	3300027289	Marine Gutless Worms Symbiont	LKRLLTEAWFGIQQSVADQAIDQWRVHLNACVKAKGKHFENML
Ga0209787_11769171	3300027289	Marine Gutless Worms Symbiont	MLKLNADELKRLLIEAWFGIQQSVADQAIDPWRVHLNACVKAK
Ga0209787_12071911	3300027289	Marine Gutless Worms Symbiont	LHLIEAWLGIQQSIADKAIDEWRVHLNACVKAKGKHIEDML
Ga0209787_12352283	3300027289	Marine Gutless Worms Symbiont	VKLRLIEACFGIQQIVADQATDQWRVCRNACVKAKGKHLKTCYDVL
Ga0209787_12877171	3300027289	Marine Gutless Worms Symbiont	LRLIEVWLGIQQNIADQAIDEWQVHLNACVKAKGKHIENML
Ga0209680_10302152	3300027392	Marine Gutless Worms Symbiont	LRLIEAWLGIQQSIADQAIDEWRVHLNACVKAKGKHIENML
Ga0209680_10681621	3300027392	Marine Gutless Worms Symbiont	LIEAWLAIQQSVTAQAIDQWRVHLNACVKAKGKHYENML
Ga0209680_10694871	3300027392	Marine Gutless Worms Symbiont	VRLIEAWLGIQQSVADQAIDEWRVHLNACVKAKEKHIENML
Ga0209680_10950482	3300027392	Marine Gutless Worms Symbiont	LRLIEAWLGILQSIADQAIDEWRVHLNACIKAKGKHIENML
Ga0209680_11281611	3300027392	Marine Gutless Worms Symbiont	MNADELKRLFIKVQFGIQQSVVDQATDQWRVCLNACVKAKGKHFEHML
Ga0209680_11367112	3300027392	Marine Gutless Worms Symbiont	LKLRLIEAWFGIQPSIANQAIVQWRVHLNACVRAKEKHFENIL
Ga0209680_12177551	3300027392	Marine Gutless Worms Symbiont	ANELKLRLIEAWFGIQKSVADQAIDQWRVCLNACVKAKGKHAIV
Ga0209568_10068011	3300027544	Marine Gutless Worms Symbiont	VFIESVKDVEKLKLRLIEAWSGIHPSIVDQAIDQWRVCLNAKHFELML
Ga0209568_10088301	3300027544	Marine Gutless Worms Symbiont	MGDLQLRLIEAWSAIHQSMIDQAIDLWRVRLNACVDAKGKHFEHML
Ga0209568_10281993	3300027544	Marine Gutless Worms Symbiont	LEELKLRLIEAWSGIHQSVIDQAIDQWRVRLNAYVNTEGKHFEHML
Ga0209568_10569921	3300027544	Marine Gutless Worms Symbiont	IEAWSGVHQTITDQAIGQWRVRLNARVDAKGKHFEHML
Ga0209679_10600071	3300027557	Marine Gutless Worms Symbiont	DLKQRLIEAWSGITQAVFDKAIDQWTVRLRACVKARGRHFEQLL
Ga0209679_11107801	3300027557	Marine Gutless Worms Symbiont	DLKQRLIEAWSGITQAVFDKAIDQWTVRLRACVKARGRHFEHLL
Ga0209678_13156701	3300027615	Marine Gutless Worms Symbiont	LIEEWSGIQQGVIDQGIDQWRDRLNACVKAKSNLEHLL
Ga0170819_169019431	3300031469	Forest Soil	VDELKLRLIEAWSGIQQSVIDYAIDQWRVRLNACVKAKGKHFEHML