Metagenome / Metatranscriptome Family F091442

Basic Information
Family ID	F091442
Family Type	Metagenome / Metatranscriptome
Number of Sequences	107
Average Sequence Length	41 residues
Representative Sequence	FTEFELRQIAAVRKELDQEYETSITPLARSSQPRVSSKSAP
Number of Associated Samples	84
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	88.79 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (73.832 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (15.888 % of family members)
Environment Ontology (ENVO)	Unclassified (35.514 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (42.056 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF13358	DDE_3	2.80
PF04392	ABC_sub_bind	1.87
PF13586	DDE_Tnp_1_2	1.87
PF13683	rve_3	1.87
PF13577	SnoaL_4	1.87
PF00005	ABC_tran	0.93
PF00274	Glycolytic	0.93
PF06568	DUF1127	0.93
PF13551	HTH_29	0.93
PF01497	Peripla_BP_2	0.93
PF00313	CSD	0.93
PF13546	DDE_5	0.93
PF14535	AMP-binding_C_2	0.93
PF17158	MASE4	0.93
PF13751	DDE_Tnp_1_6	0.93
PF13700	DUF4158	0.93
PF09140	MipZ	0.93
PF00529	CusB_dom_1	0.93
PF11306	DUF3108	0.93
PF14602	Hexapep_2	0.93
PF01548	DEDD_Tnp_IS110	0.93
PF02899	Phage_int_SAM_1	0.93
PF00216	Bac_DNA_binding	0.93
PF14224	DUF4331	0.93
PF03466	LysR_substrate	0.93
PF05685	Uma2	0.93
PF07799	DUF1643	0.93
PF12248	Methyltransf_FA	0.93
PF07503	zf-HYPF	0.93
PF01555	N6_N4_Mtase	0.93
PF00196	GerE	0.93
PF13426	PAS_9	0.93
PF01734	Patatin	0.93
PF00107	ADH_zinc_N	0.93
PF05598	DUF772	0.93
PF04386	SspB	0.93
PF14503	YhfZ_C	0.93
PF00378	ECH_1	0.93
PF00027	cNMP_binding	0.93
PF02900	LigB	0.93
PF04773	FecR	0.93
PF02371	Transposase_20	0.93
PF13547	GTA_TIM	0.93
PF09928	DUF2160	0.93
PF03150	CCP_MauG	0.93
PF14305	ATPgrasp_TupA	0.93
PF00872	Transposase_mut	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.87
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.87
COG5457	Uncharacterized conserved protein YjiS, DUF1127 family	Function unknown [S]	0.93
COG0068	Hydrogenase maturation factor HypF (carbamoyltransferase)	Posttranslational modification, protein turnover, chaperones [O]	0.93
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	0.93
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	0.93
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.93
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	0.93
COG4607	ABC-type enterochelin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.93
COG4594	ABC-type Fe3+-citrate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.93
COG4592	ABC-type Fe2+-enterobactin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.93
COG4558	ABC-type hemin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.93
COG4333	Uncharacterized conserved protein, DUF1643 domain	Function unknown [S]	0.93
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.93
COG3588	Fructose-bisphosphate aldolase class 1	Carbohydrate transport and metabolism [G]	0.93
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.93
COG2969	Stringent starvation protein B, binds SsrA peptide	Posttranslational modification, protein turnover, chaperones [O]	0.93
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.93
COG1858	Cytochrome c peroxidase	Posttranslational modification, protein turnover, chaperones [O]	0.93
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.93
COG1192	ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ	Cell cycle control, cell division, chromosome partitioning [D]	0.93
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.93
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.93
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.93
COG0614	ABC-type Fe3+-hydroxamate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.83 %
Unclassified	root	N/A	26.17 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.83 %
Unclassified	root	N/A	26.17 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.83 %
Unclassified	root	N/A	26.17 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	59.81 %
Unclassified	root	N/A	26.17 %
Synergistetes	phylum	All Organisms → cellular organisms → Bacteria → Synergistetes	1.87 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.93 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	50.47 %
Unclassified	root	N/A	26.17 %
unclassified Synergistota	no rank	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota	1.87 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.93 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	25.23 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	14.02 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.93 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.93 %
Legionellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales	0.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	14.02 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	5.61 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3.74 %
Roseiarcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae	2.80 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1.87 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
Azospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae	0.93 %
Boseaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae	0.93 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.93 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.93 %
Legionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae	0.93 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.93 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.93 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	0.93 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	14.02 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.74 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	2.80 %
Roseiarcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus	2.80 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	1.87 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
Vineibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter	0.93 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.93 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.93 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.93 %
Legionella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella	0.93 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.93 %
Bosea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea	0.93 %
Cupriavidus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus	0.93 %
Skermanella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella	0.93 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	14.02 %
Roseiarcus fermentans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	2.80 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	1.87 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	1.87 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
Methylobacterium isbiliense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium isbiliense	0.93 %
Bradyrhizobium altum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum	0.93 %
Skermanella mucosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa	0.93 %
Vineibacter terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae	0.93 %
unclassified Microvirga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga	0.93 %
unclassified Hyphomicrobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium	0.93 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.93 %
unclassified Cupriavidus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus	0.93 %
unclassified Bosea	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea	0.93 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.93 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.93 %
Legionella parisiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella parisiensis	0.93 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	14.02 %
Roseiarcus fermentans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	2.80 %
Mesorhizobium sp. LNJC395A00	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00	1.87 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	1.87 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.93 %
Bosea sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp.	0.93 %
Microvirga sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp.	0.93 %
Cupriavidus sp. IK-TO18	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. IK-TO18	0.93 %
Bradyrhizobium sp. BTAi1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi1	0.93 %
Pyxidicoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus	0.93 %
Methylobacterium isbiliense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium isbiliense	0.93 %
Bradyrhizobium altum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum	0.93 %
Skermanella mucosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa	0.93 %
Vineibacter terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae	0.93 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.93 %
Legionella parisiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella parisiensis	0.93 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	14.02 %
Roseiarcus fermentans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	2.80 %
Mesorhizobium sp. LNJC395A00	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00	1.87 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	1.87 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
unclassified Pyxidicoccus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus → unclassified Pyxidicoccus	0.93 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.93 %
Bosea sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp.	0.93 %
Microvirga sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp.	0.93 %
Cupriavidus sp. IK-TO18	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. IK-TO18	0.93 %
Bradyrhizobium sp. BTAi1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi1	0.93 %
Methylobacterium isbiliense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium isbiliense	0.93 %
Bradyrhizobium altum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum	0.93 %
Skermanella mucosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa	0.93 %
Vineibacter terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae	0.93 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.93 %
Legionella parisiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella parisiensis	0.93 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.17 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	14.02 %
Roseiarcus fermentans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	2.80 %
Mesorhizobium sp. LNJC395A00	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00	1.87 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	1.87 %
Synergistetes bacterium ADurb.BinA166	species	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1.87 %
Pyxidicoccus sp. SCPEA002	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus → unclassified Pyxidicoccus → Pyxidicoccus sp. SCPEA002	0.93 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.93 %
Bosea sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp.	0.93 %
Microvirga sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp.	0.93 %
Cupriavidus sp. IK-TO18	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. IK-TO18	0.93 %
Bradyrhizobium sp. BTAi1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi1	0.93 %
Methylobacterium isbiliense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium isbiliense	0.93 %
Bradyrhizobium altum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum	0.93 %
Skermanella mucosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa	0.93 %
Vineibacter terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae	0.93 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.93 %
Legionella parisiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella parisiensis	0.93 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459019\|G14TP7Y01CPAKL	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	728	Open in IMG/M
3300000955\|JGI1027J12803_102841517	All Organisms → cellular organisms → Bacteria	784	Open in IMG/M
3300001686\|C688J18823_10818396	Not Available	591	Open in IMG/M
3300002568\|C688J35102_120651436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	1297	Open in IMG/M
3300004081\|Ga0063454_101841105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum	531	Open in IMG/M
3300005441\|Ga0070700_101769587	Not Available	532	Open in IMG/M
3300005456\|Ga0070678_100448713	All Organisms → cellular organisms → Bacteria → Proteobacteria	1129	Open in IMG/M
3300005457\|Ga0070662_101224042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	646	Open in IMG/M
3300005457\|Ga0070662_101434511	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300005552\|Ga0066701_10512045	Not Available	742	Open in IMG/M
3300005559\|Ga0066700_10209037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1351	Open in IMG/M
3300005618\|Ga0068864_100216994	All Organisms → cellular organisms → Bacteria → Proteobacteria	1763	Open in IMG/M
3300005618\|Ga0068864_101765431	Not Available	624	Open in IMG/M
3300005764\|Ga0066903_102878554	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300005764\|Ga0066903_103556453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	839	Open in IMG/M
3300005764\|Ga0066903_105105628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	695	Open in IMG/M
3300005764\|Ga0066903_108887295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	509	Open in IMG/M
3300005841\|Ga0068863_101162836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella mucosa	777	Open in IMG/M
3300006969\|Ga0075419_10934652	Not Available	627	Open in IMG/M
3300009098\|Ga0105245_11266996	All Organisms → cellular organisms → Bacteria	786	Open in IMG/M
3300009520\|Ga0116214_1138659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp.	903	Open in IMG/M
3300009698\|Ga0116216_10851470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	546	Open in IMG/M
3300009789\|Ga0126307_10085984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2483	Open in IMG/M
3300009789\|Ga0126307_10631767	Not Available	864	Open in IMG/M
3300010037\|Ga0126304_10892234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	604	Open in IMG/M
3300010040\|Ga0126308_11110488	Not Available	557	Open in IMG/M
3300010041\|Ga0126312_11065030	Not Available	593	Open in IMG/M
3300010042\|Ga0126314_10183975	All Organisms → cellular organisms → Bacteria	1467	Open in IMG/M
3300010044\|Ga0126310_10001331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	9400	Open in IMG/M
3300010166\|Ga0126306_10649389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp.	843	Open in IMG/M
3300010343\|Ga0074044_10978883	Not Available	554	Open in IMG/M
3300010366\|Ga0126379_10336101	Not Available	1534	Open in IMG/M
3300010366\|Ga0126379_10599517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1187	Open in IMG/M
3300010375\|Ga0105239_10831745	All Organisms → cellular organisms → Bacteria	1058	Open in IMG/M
3300010398\|Ga0126383_10523532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1248	Open in IMG/M
3300010398\|Ga0126383_13197541	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Pyxidicoccus → unclassified Pyxidicoccus → Pyxidicoccus sp. SCPEA002	535	Open in IMG/M
3300012212\|Ga0150985_101383113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	523	Open in IMG/M
3300012356\|Ga0137371_11321596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BTAi1	532	Open in IMG/M
3300012359\|Ga0137385_10204530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1723	Open in IMG/M
3300012362\|Ga0137361_10293904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1486	Open in IMG/M
3300012383\|Ga0134033_1003373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	766	Open in IMG/M
3300012986\|Ga0164304_10273213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	1145	Open in IMG/M
3300014158\|Ga0181521_10175728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1200	Open in IMG/M
3300014158\|Ga0181521_10457436	Not Available	618	Open in IMG/M
3300014159\|Ga0181530_10346457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Vineibacter → Vineibacter terrae	768	Open in IMG/M
3300014200\|Ga0181526_10550784	All Organisms → cellular organisms → Bacteria → Proteobacteria	729	Open in IMG/M
3300015371\|Ga0132258_12783270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1219	Open in IMG/M
3300016270\|Ga0182036_10285044	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	1250	Open in IMG/M
3300016294\|Ga0182041_10022831	All Organisms → cellular organisms → Bacteria	3865	Open in IMG/M
3300016371\|Ga0182034_10015444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4416	Open in IMG/M
3300017975\|Ga0187782_10210809	Not Available	1455	Open in IMG/M
3300018038\|Ga0187855_10089789	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1864	Open in IMG/M
3300018432\|Ga0190275_12244371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	624	Open in IMG/M
3300018468\|Ga0066662_10965530	Not Available	841	Open in IMG/M
3300018469\|Ga0190270_11117527	All Organisms → cellular organisms → Bacteria → Proteobacteria	822	Open in IMG/M
3300021404\|Ga0210389_10535093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	922	Open in IMG/M
3300025899\|Ga0207642_10176575	Not Available	1160	Open in IMG/M
3300025900\|Ga0207710_10632853	Not Available	560	Open in IMG/M
3300025929\|Ga0207664_10953373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	769	Open in IMG/M
3300025931\|Ga0207644_11454076	Not Available	576	Open in IMG/M
3300025933\|Ga0207706_10108948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	2437	Open in IMG/M
3300026023\|Ga0207677_11643559	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300026095\|Ga0207676_11728049	Not Available	624	Open in IMG/M
3300026118\|Ga0207675_100524185	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300026142\|Ga0207698_10306810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1480	Open in IMG/M
3300026142\|Ga0207698_12519506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	524	Open in IMG/M
3300027824\|Ga0209040_10000607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	27816	Open in IMG/M
3300029999\|Ga0311339_11872719	All Organisms → cellular organisms → Bacteria → Proteobacteria	518	Open in IMG/M
3300030503\|Ga0311370_10341543	All Organisms → cellular organisms → Bacteria → Proteobacteria	1913	Open in IMG/M
3300030707\|Ga0310038_10196691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Legionellaceae → Legionella → Legionella parisiensis	965	Open in IMG/M
3300031543\|Ga0318516_10857823	Not Available	512	Open in IMG/M
3300031573\|Ga0310915_10040313	All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166	2972	Open in IMG/M
3300031680\|Ga0318574_10627126	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300031744\|Ga0306918_10771390	Not Available	751	Open in IMG/M
3300031794\|Ga0318503_10072244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1075	Open in IMG/M
3300031846\|Ga0318512_10566958	Not Available	578	Open in IMG/M
3300031879\|Ga0306919_10164733	All Organisms → cellular organisms → Bacteria	1627	Open in IMG/M
3300031879\|Ga0306919_10548930	Not Available	891	Open in IMG/M
3300031890\|Ga0306925_10281998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1788	Open in IMG/M
3300031890\|Ga0306925_11517514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	655	Open in IMG/M
3300031912\|Ga0306921_10162377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2615	Open in IMG/M
3300031912\|Ga0306921_10453486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1494	Open in IMG/M
3300031942\|Ga0310916_11128316	Not Available	650	Open in IMG/M
3300031945\|Ga0310913_10476303	Not Available	886	Open in IMG/M
3300031954\|Ga0306926_11957569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium isbiliense	660	Open in IMG/M
3300032009\|Ga0318563_10463423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. IK-TO18	685	Open in IMG/M
3300032035\|Ga0310911_10368123	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300032076\|Ga0306924_10988517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	925	Open in IMG/M
3300032770\|Ga0335085_10546681	All Organisms → cellular organisms → Bacteria → Proteobacteria	1313	Open in IMG/M
3300032892\|Ga0335081_10797758	Not Available	1129	Open in IMG/M
3300032896\|Ga0335075_10059288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5271	Open in IMG/M
3300032896\|Ga0335075_10105904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3662	Open in IMG/M
3300032896\|Ga0335075_10706017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	968	Open in IMG/M
3300032896\|Ga0335075_10832088	Not Available	859	Open in IMG/M
3300032896\|Ga0335075_10994009	Not Available	754	Open in IMG/M
3300032896\|Ga0335075_11506415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	559	Open in IMG/M
3300032897\|Ga0335071_10047496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	4240	Open in IMG/M
3300032897\|Ga0335071_10324261	Not Available	1493	Open in IMG/M
3300032897\|Ga0335071_12138886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00	502	Open in IMG/M
3300032954\|Ga0335083_11343960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC395A00	548	Open in IMG/M
3300032955\|Ga0335076_10857498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	790	Open in IMG/M
3300033134\|Ga0335073_10092344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3929	Open in IMG/M
3300033134\|Ga0335073_10763646	Not Available	1044	Open in IMG/M
3300033134\|Ga0335073_10833543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	983	Open in IMG/M
3300033134\|Ga0335073_11545860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	637	Open in IMG/M
3300033289\|Ga0310914_11116463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	690	Open in IMG/M
3300033805\|Ga0314864_0008301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans	1969	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.37%
Host-Associated	Host-Associated	18.69%
Engineered	Engineered	0.93%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.77%
Plants	Host-Associated → Plants	18.69%
Aquatic	Environmental → Aquatic	5.61%
Solid Waste	Engineered → Solid Waste	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	72.90%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.21%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.48%
Freshwater	Environmental → Aquatic → Freshwater	5.61%
Peat	Environmental → Terrestrial → Peat	1.87%
Grass	Engineered → Solid Waste → Grass	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.79%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	18.69%
Loam	Environmental → Terrestrial → Soil → Loam	8.41%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.41%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.74%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.74%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.87%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.93%
Composting	Engineered → Solid Waste → Grass → Composting	0.93%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	21.50%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	18.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.41%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	5.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.74%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.74%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.80%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.87%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.93%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	15.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.28%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	7.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.67%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	3.74%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.74%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.80%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.80%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.80%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.80%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.87%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.93%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.93%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.93%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.93%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.93%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009520	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG	Environmental	Open in IMG/M
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012383	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300014158	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG	Environmental	Open in IMG/M
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental	Open in IMG/M
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018038	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030503	III_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030707	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031794	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033134	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033805	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F091442

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4MG_01417500	2170459019	Switchgrass, Maize And Mischanthus Litter	EFELRQIAAVRKDLDAEYDAKLTPRAGHPTHAFSSKSAP
JGI1027J12803_1028415172	3300000955	Soil	LRFTEFELRQIAAIRNDLDAEYDAKVTRSGRSSQPRFSSKSVP*
C688J18823_108183962	3300001686	Soil	LRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP*
C688J35102_1206514364	3300002568	Soil	GLRFTEFELRQIAAVRKDLGAEYEAMITRSDRASQTRVASRSVP*
Ga0063454_1018411052	3300004081	Soil	EFELRQIAAVRKDLDAEYEATITRSGRSSQSRVSSKTAP*
Ga0070700_1017695872	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	NEFELRQIAAVRKDLDAEYEATITRSDRPSQSHVSSKTAP*
Ga0070678_1004487131	3300005456	Miscanthus Rhizosphere	PFTEFELRQLAAIREDLNREYEAAITPTARSSQPRFSSRNVL*
Ga0070662_1012240421	3300005457	Corn Rhizosphere	RFNEFELRQIAAVRKDLDAEYESAITRSDRPSQSHVSSKTAP*
Ga0070662_1014345111	3300005457	Corn Rhizosphere	LPFTEFELRQLAAIREDLNREYEAAITPTARSSQPRFSSRNVL*
Ga0066701_105120451	3300005552	Soil	WRGLRFTEFELRQIAAVRKELDAEYEAKLTPSGRSSHPRFSSKSAP*
Ga0066700_102090371	3300005559	Soil	FELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP*
Ga0068864_1002169941	3300005618	Switchgrass Rhizosphere	RFSEFELRQIAAVRKDLDTEYDTTITRSGRSSQPRFSSKSTP*
Ga0068864_1017654313	3300005618	Switchgrass Rhizosphere	EFELRQLAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP*
Ga0066903_1028785543	3300005764	Tropical Forest Soil	ELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP*
Ga0066903_1035564531	3300005764	Tropical Forest Soil	TEFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP*
Ga0066903_1051056282	3300005764	Tropical Forest Soil	FELRQIAAVRNDLDAEYDGKVTRSGSPSQPRFSSKSAP*
Ga0066903_1088872952	3300005764	Tropical Forest Soil	AESWRGLRFTEFELRQLDAVRKELDADYETSIARLDRSSRSRVSSKSAP*
Ga0068863_1011628362	3300005841	Switchgrass Rhizosphere	AAERWRGLRFSEFELRQIAAVRKDLDADYGTTITHSGRSSQPRFSSKSTP*
Ga0075419_109346522	3300006969	Populus Rhizosphere	RRFTEFELRQIAAVQKDLDAEYEATRSDRASQTNVSSSSAP*
Ga0105245_112669963	3300009098	Miscanthus Rhizosphere	LRQLAAVRKDLDAEYEATITRSGRSSQSRVSSKTAP*
Ga0116214_11386593	3300009520	Peatlands Soil	FTEFELRQIAAVRKELDQEYETSITPLARSSQPRVSSKSAP*
Ga0116216_108514701	3300009698	Peatlands Soil	DRWRGLRFTEFELRQIAAVRKDLVDEYQTSITSLATSSQPRVSSKSKP*
Ga0126307_100859845	3300009789	Serpentine Soil	RFTEFELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP*
Ga0126307_106317671	3300009789	Serpentine Soil	LRQIAAVRKDLDTEYQATITRSDRPAHSRISSKATP*
Ga0126304_108922341	3300010037	Serpentine Soil	RFTEFELRQIAALRRDLDAEYEAAITRPDRPSKTRVSSRSAP*
Ga0126308_111104882	3300010040	Serpentine Soil	FELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP*
Ga0126312_110650303	3300010041	Serpentine Soil	LRQIAAVRKDLDAEYEAAITRLDRTSQTRVSSRSAP*
Ga0126314_101839751	3300010042	Serpentine Soil	TDFELRQIAAIQTDLDPEYEAAITRSDTSSHPRFSGKSAP*
Ga0126310_1000133111	3300010044	Serpentine Soil	FTEFELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP*
Ga0126306_106493893	3300010166	Serpentine Soil	EFELRQIAAVRKDLDTEYEAMITRSDRASQTRVSSRCVP*
Ga0074044_109788831	3300010343	Bog Forest Soil	LRFTGFELPQLTALRKELDEEYQTSITSPARSSQPRFSSKSTP*
Ga0126379_103361013	3300010366	Tropical Forest Soil	LRFTEFELRQLDAVRKELDADYETSIARLDRSSRSRVSSKSAP*
Ga0126379_105995171	3300010366	Tropical Forest Soil	EFELRQIAAVRNDLDAEYDGKVTRSGSPSQPRFSSKSAP*
Ga0105239_108317452	3300010375	Corn Rhizosphere	LRFSEFELRQIAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP*
Ga0126383_105235324	3300010398	Tropical Forest Soil	AAESWRGLRFTEFELRQLDAVRKELDADYETSIARSDRSSRSRVSSKSAP*
Ga0126383_131975412	3300010398	Tropical Forest Soil	ESWRGLRFTEFELRQLDAVRKELDADYESSIARLDRSSRPRVSSKSAP*
Ga0150985_1013831132	3300012212	Avena Fatua Rhizosphere	FELRQIAAVRKDLDAEYEAAITRSDRTSQTRVSSRSVP*
Ga0137371_113215962	3300012356	Vadose Zone Soil	WRGLRFTEFELRQVAAVRKELDAEYEAKLTPSGRSSHSRFSSKSAP*
Ga0137385_102045304	3300012359	Vadose Zone Soil	TEFELRQVAAVRKELDAEYEAKLTPSGRSSHSRFSSKSAP*
Ga0137361_102939041	3300012362	Vadose Zone Soil	EFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP*
Ga0134033_10033731	3300012383	Grasslands Soil	SEFELRQIAAVRKDLDAEYEATITRSRRSSQPRFSSTATP*
Ga0164304_102732131	3300012986	Soil	TEFELRQLAAIREDLNREYEAAIIPTARSSQPRFSSRNVP*
Ga0181521_101757282	3300014158	Bog	EFELRQLAAVRKELDEEYQATITPQARSSQPRVSSKSAP*
Ga0181521_104574361	3300014158	Bog	LRQLAAVRKELDEEYQATITPQARSSQPRVSSKSAP*
Ga0181530_103464572	3300014159	Bog	FELRQLAAVRKELDEEYQATITPQARSSQPRVSSKSAP*
Ga0181526_105507842	3300014200	Bog	FELRQIAAVRKELDQEYEDSITPLARSSQPRVSSKSAP*
Ga0132258_127832701	3300015371	Arabidopsis Rhizosphere	FELRQLDAVRNELDAEYETSITRSDRTSRPRVSSKSVP*
Ga0182036_102850442	3300016270	Soil	LRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP
Ga0182041_100228311	3300016294	Soil	EFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP
Ga0182034_100154441	3300016371	Soil	SWRGLRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP
Ga0187782_102108091	3300017975	Tropical Peatland	EFELRQIAAVRKELDQEYEASITPLARSSQPRVSSKNAP
Ga0187855_100897893	3300018038	Peatland	RFTEFELRQLAVVRKELDEEYQATITPQARSSQPRVSGKSAP
Ga0190275_122443711	3300018432	Soil	RWRGLRFTEFELRQIAAVQKDLDTEYEATIARSDRRAQTRFSSTSQP
Ga0066662_109655302	3300018468	Grasslands Soil	GLRFSEFELRQIAAVRKDLDTEYDTTITRSGRSSQPRFSSTSTP
Ga0190270_111175272	3300018469	Soil	ELRQIAAVRKDLDAEYEATRSDRASQTRVSSRSAP
Ga0210389_105350931	3300021404	Soil	TEFELRQIAAVRKDLDHEYQISTTPLARSAQPRVSSKSAP
Ga0207642_101765752	3300025899	Miscanthus Rhizosphere	NEFELRQIAAVRKDLDAEYEATITRSGRSSQSRVSSKTAP
Ga0207710_106328531	3300025900	Switchgrass Rhizosphere	LRQIAAVRKDLDAEYESTITLSDRPSQSHVSSKTAP
Ga0207664_109533732	3300025929	Agricultural Soil	TEFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP
Ga0207644_114540762	3300025931	Switchgrass Rhizosphere	RFTEFELRQIAAVQKDLDAEYEATRSDRASQTRVSSRSAP
Ga0207706_101089481	3300025933	Corn Rhizosphere	RFNEFELRQIAAVRKDLDAEYESAITRSDRPSQSHVSSKTAP
Ga0207677_116435592	3300026023	Miscanthus Rhizosphere	GEFELRQIAAVRKDLGAEYEATITRSGQPSQPSFSSRSAP
Ga0207676_117280492	3300026095	Switchgrass Rhizosphere	RQIAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP
Ga0207675_1005241851	3300026118	Switchgrass Rhizosphere	AERWRGLRFSEFELRQIAAVRKDLDAEYEATITRSGRSSQPRFSSTSTP
Ga0207698_103068101	3300026142	Corn Rhizosphere	TEFELRQLAAIREDLNREYEAAIIPTARSSQPRFSSRNVP
Ga0207698_125195062	3300026142	Corn Rhizosphere	FTEFELRQIAAVQKDLDAEYEATRSDRASQTRVSSRSAP
Ga0209040_100006071	3300027824	Bog Forest Soil	RQLAALRKELDEEYEASITAPARSSQPRFSSKSVP
Ga0311339_118727191	3300029999	Palsa	TEFELRQIAAVRKELDGEYQASVTPLARSSQPRVSSKSKP
Ga0311370_103415431	3300030503	Palsa	TEFELRQIAAVRKELDDEYQASVTPLARSSQPRVSSKSKP
Ga0310038_101966912	3300030707	Peatlands Soil	GLRFTEFELRQLAVLRKELDGDYEASIMSSARSSQPRFSGKIHCRS
Ga0318516_108578231	3300031543	Soil	EFELRQIAAVRKELDDEYQTSITPLARSSQPRVSSKSAP
Ga0310915_100403131	3300031573	Soil	GLRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP
Ga0318574_106271261	3300031680	Soil	AYVDAVRKELDADYETSIARSDRTSRPRVSSKLAP
Ga0306918_107713901	3300031744	Soil	ELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP
Ga0318503_100722442	3300031794	Soil	LRFTEFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP
Ga0318512_105669581	3300031846	Soil	TEFELRQLDVVRKDLDAEYEASITRSDRPSRPRVSSNSAP
Ga0306919_101647331	3300031879	Soil	FELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP
Ga0306919_105489302	3300031879	Soil	TEFELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP
Ga0306925_102819981	3300031890	Soil	EFELRQLDAVRKELDADYETSIARLDRSSRPRVSSKSAP
Ga0306925_115175141	3300031890	Soil	ESWRGLRFTEFELRQLDAVRKELDADYETSIAQSDRTSRPRVSSKLAP
Ga0306921_101623775	3300031912	Soil	ESWRGLRFTEFELRQLDAVRKELDADYETSIAQLDRSSRPRVSSKSAP
Ga0306921_104534861	3300031912	Soil	LRFTEFELRQIAAVRKELDDEYQTSITPLARSSQPSVSSKSAP
Ga0310916_111283161	3300031942	Soil	LRFTEFELRQLDAVRKELDADYETSIARSDRTSRPRLSSKLAP
Ga0310913_104763031	3300031945	Soil	EFELRQLDAVRKELDADYETSIARSDRTSRPRVSSKLAP
Ga0306926_119575691	3300031954	Soil	RQIAAVRKELDDENQTSITPLARSAQPRVSSKSKP
Ga0318563_104634231	3300032009	Soil	FTEFELRQIAAVRQELDKEYEDSITPLARSSQPRVSSKSAP
Ga0310911_103681231	3300032035	Soil	ESWRGLRFTEFELRQLDAVRKELDADYETSIARSDRSSRPRVSSKSAP
Ga0306924_109885171	3300032076	Soil	RFTEFELRQIAAVRKELHQEYEASITPPARSSHARVSSKSRP
Ga0335085_105466811	3300032770	Soil	TEFELRQIAAVRKELDDEYHASITPLARSAQPRVSSKSKP
Ga0335081_107977582	3300032892	Soil	AERWRGLRFSEFELRQLTTVRKELDEEYQTAITPPARSSQPRASSKSAP
Ga0335075_100592881	3300032896	Soil	FELRQIAAVRKELDNEYQTSISPLARSSQTRVSSKSAP
Ga0335075_101059047	3300032896	Soil	ELRQIAAVRKELDNEYQTSISPLARSSQTRVSSKSAP
Ga0335075_107060172	3300032896	Soil	TEFELRQISAVRKELDDEYHASITPLARSAQPRVSSKSKP
Ga0335075_108320881	3300032896	Soil	LRQIAAVRKELDDEYHASITPLARSAQPGVSSKSAP
Ga0335075_109940092	3300032896	Soil	TEFKLRQIAAVRKELDQEYQASVTPLARSSQPRVSSKSAP
Ga0335075_115064151	3300032896	Soil	TEFELRQIAAVRKELDNEYQTSISPLARSSQTRVSSKSAP
Ga0335071_100474967	3300032897	Soil	DCQPARQLAALRKEFDEEYEASIKSPARSSQPRFSSKNAP
Ga0335071_103242613	3300032897	Soil	LRQIAAVRKELDQEYEASITPLGSSQPRVSSKSAP
Ga0335071_121388861	3300032897	Soil	DRWRGLRFTEFEPRQIAAVRKELDQQYEASITPLARSSQPRVSSKSAP
Ga0335083_113439601	3300032954	Soil	FTEFEPRQIAAVRKELDQQYEASITPLARSSQPRVSSKSAP
Ga0335076_108574981	3300032955	Soil	LRFTEFELRQIAAVRKELDQEYEASATPLARSSQPRFSSKKAP
Ga0335073_100923441	3300033134	Soil	TEFELRQLAILRKELDEEYQTSIMSPARSSQPRFSSKSTP
Ga0335073_107636464	3300033134	Soil	TEFKLRQIAAVRKELDQEYEASVTPLARSSQPRVSSKSAP
Ga0335073_108335432	3300033134	Soil	LRQIAAVRKELDQEYQASVTPLARSSQPRVSSKSAP
Ga0335073_115458601	3300033134	Soil	AERWRGLRFTQFELRQIAAVRKDLDDEYQTSITPLARSAQPRLSSKSKP
Ga0310914_111164631	3300033289	Soil	AEGWRGLRFTEFELRQLDVVRKDLDAEYEASITRSDRPSRPRISSNSAP
Ga0314864_0008301_2_124	3300033805	Peatland	TEFELRQIAAVRKDLDQEYEASITPLARSSQPRFSSKNAP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign