| Basic Information | |
|---|---|
| Family ID | F091424 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKAT |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 28.04 % |
| % of genes from short scaffolds (< 2000 bps) | 24.30 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.963 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.944 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.028 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.91% Coil/Unstructured: 76.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07659 | DUF1599 | 71.03 |
| PF13155 | Toprim_2 | 4.67 |
| PF12705 | PDDEXK_1 | 1.87 |
| PF13362 | Toprim_3 | 0.93 |
| PF05257 | CHAP | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.96 % |
| All Organisms | root | All Organisms | 28.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003404|JGI25920J50251_10140474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300003411|JGI25911J50253_10056355 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300004112|Ga0065166_10241513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300005580|Ga0049083_10256473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300005805|Ga0079957_1181569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300007538|Ga0099851_1271531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300007538|Ga0099851_1290742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300007542|Ga0099846_1210100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300008107|Ga0114340_1041990 | All Organisms → Viruses → Predicted Viral | 3973 | Open in IMG/M |
| 3300008107|Ga0114340_1176567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300008110|Ga0114343_1038881 | All Organisms → Viruses → Predicted Viral | 1920 | Open in IMG/M |
| 3300008266|Ga0114363_1020171 | All Organisms → Viruses → Predicted Viral | 4818 | Open in IMG/M |
| 3300008448|Ga0114876_1001341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18275 | Open in IMG/M |
| 3300009068|Ga0114973_10555412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300009180|Ga0114979_10538182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300009181|Ga0114969_10273603 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300009183|Ga0114974_10051751 | All Organisms → Viruses → Predicted Viral | 2753 | Open in IMG/M |
| 3300009184|Ga0114976_10085924 | All Organisms → Viruses → Predicted Viral | 1809 | Open in IMG/M |
| 3300010160|Ga0114967_10385187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300017774|Ga0181358_1067118 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
| 3300022200|Ga0196901_1145046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300027707|Ga0209443_1142141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300027734|Ga0209087_1246415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300027782|Ga0209500_10356198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 602 | Open in IMG/M |
| 3300027785|Ga0209246_10382871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 531 | Open in IMG/M |
| 3300027816|Ga0209990_10233909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300031787|Ga0315900_10616340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300031857|Ga0315909_10627236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300034066|Ga0335019_0777783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300034117|Ga0335033_0261571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.15% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.48% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.87% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.87% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.87% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.93% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.93% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.93% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM37_10076475 | 3300001850 | Marine Plankton | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTVTTSTNKA |
| B570J29032_1095955084 | 3300002408 | Freshwater | VKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNK |
| metazooDRAFT_14975964 | 3300002471 | Lake | MIKRFGPYKGSKQNGGRPIYVFKRKKKDGTVVTTSSNKARVDYEDSTGKT |
| JGI25908J49247_101171081 | 3300003277 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVFKRKRKDGTVETTSSNKARVDYEKATGKSLPR |
| JGI25920J50251_101404741 | 3300003404 | Freshwater Lake | VRIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKLKRN |
| JGI25911J50253_100563555 | 3300003411 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYK |
| Ga0066177_100408191 | 3300004096 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVFKRKRKDGSVETTSSNKARVDYEK |
| Ga0065166_102415131 | 3300004112 | Freshwater Lake | MRFGPYKGSKQNGGRPIYVFKRKKKNGEVVTTSSNKARVDYE |
| Ga0066180_103704441 | 3300004128 | Freshwater Lake | MKIFGPYKGSKANGGRPIYVFKRKKKDGTTTTTSSNKARVDYEKATGKTL |
| Ga0068876_105189461 | 3300005527 | Freshwater Lake | MKKSIKKTIKRIFGPYKGSEQNGGRPIYVIKKRTKDGKVVTTSSNKA |
| Ga0049083_102564732 | 3300005580 | Freshwater Lentic | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDYKKATGKKLTR |
| Ga0049081_103504511 | 3300005581 | Freshwater Lentic | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTESTSTN |
| Ga0049080_102885033 | 3300005582 | Freshwater Lentic | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTESTSTNKARLDYKKATG |
| Ga0049084_101199251 | 3300005585 | Freshwater Lentic | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLD |
| Ga0079957_11815691 | 3300005805 | Lake | MGQMKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETT |
| Ga0079957_12993251 | 3300005805 | Lake | MKKYGPYKGSKQNGGRPIYVFKKKKNGKTVTTSSNKARVDLEEST |
| Ga0103961_10623074 | 3300007216 | Freshwater Lake | VIKKFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSSNKA |
| Ga0099851_12715313 | 3300007538 | Aqueous | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARHEYEESTGKKLP |
| Ga0099851_12907421 | 3300007538 | Aqueous | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARHEYEESTGKKLPR |
| Ga0099846_12101003 | 3300007542 | Aqueous | MKIFGPYKGSKQNGGRPIYVIKRKKKDGSTTTTSTNKARKDYEDATGKTLPK |
| Ga0114340_10419909 | 3300008107 | Freshwater, Plankton | MRKIFGPYKGSKQNGGRPIYVFKRKKKDGTVVTTSSNKARVDYEEAT |
| Ga0114340_11765674 | 3300008107 | Freshwater, Plankton | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKLKR |
| Ga0114343_10388815 | 3300008110 | Freshwater, Plankton | MRKIFGPYKGSKQNGGRPIYVFKRKKKDGTVVTTSSNKARVDYEEATGKK |
| Ga0114343_11341801 | 3300008110 | Freshwater, Plankton | MKIFGPYKGSKQNGGRKIYVFKRKKKDGTTVTTSSNKA |
| Ga0114346_100523119 | 3300008113 | Freshwater, Plankton | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDFKRATM* |
| Ga0114840_10402203 | 3300008258 | Freshwater, Plankton | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTPTNKARLDYKKAT |
| Ga0114840_10409391 | 3300008258 | Freshwater, Plankton | MKIFGPYKGSKQNGGCPIYVIKRKKKDGTTETTSTNKARL |
| Ga0114336_11632351 | 3300008261 | Freshwater, Plankton | MGEVKIFGPYKGSKQNGGRPIYVIKRKKKDGSTETTST |
| Ga0114337_12594813 | 3300008262 | Freshwater, Plankton | MRKIFGPYKGSKANGGRPIYVFKRKKKDGTVVTTSSNKARVDYE |
| Ga0114353_11255421 | 3300008264 | Freshwater, Plankton | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKK* |
| Ga0114363_10201711 | 3300008266 | Freshwater, Plankton | VKIFGTYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARHDYKKATGKKLK |
| Ga0114876_10013411 | 3300008448 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDFKRATGKKLKR |
| Ga0114973_105554123 | 3300009068 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKLKRNQ |
| Ga0114968_101800751 | 3300009155 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKK |
| Ga0114968_103876383 | 3300009155 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSKQSPIGL* |
| Ga0114979_102510551 | 3300009180 | Freshwater Lake | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNKARVDYEKAT |
| Ga0114979_105381823 | 3300009180 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTVVTTSS |
| Ga0114969_102736034 | 3300009181 | Freshwater Lake | MKIFGPYKGSKANGGRPIYVIKRKKKDGSTTTTSTNKAR |
| Ga0114974_100517517 | 3300009183 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTVVTTSSNKARVDYEEAT |
| Ga0114976_100859245 | 3300009184 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSSNKARVDYEKT |
| Ga0114967_102042841 | 3300010160 | Freshwater Lake | MKIFGPYKGSKANGGRPIYVIKRKKKDGTTETTSTNKARLDY |
| Ga0114967_103851874 | 3300010160 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKLKRN |
| Ga0114986_11071042 | 3300010374 | Deep Subsurface | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSSNKARVEYEKAT |
| Ga0133913_131273694 | 3300010885 | Freshwater Lake | VKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKL |
| Ga0139557_10692511 | 3300011010 | Freshwater | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTTTTSTNKARLD |
| Ga0153805_10861773 | 3300012013 | Surface Ice | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNKARVDYEESTGKK |
| (restricted) Ga0172367_104356821 | 3300013126 | Freshwater | MAKKYGPYKGSKQNGGRPIYVFKKKKNGKTVTTSSNKARVDYE |
| (restricted) Ga0172376_100773051 | 3300014720 | Freshwater | MGKMKKFGPYKGSKQNGGRPIYVFKKKKNGKTVTTSSNKARVDFEE |
| Ga0181362_11221282 | 3300017723 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTTTTSTNKARLDYKKATG |
| Ga0181343_11470783 | 3300017766 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETSST |
| Ga0181358_10671181 | 3300017774 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTTTTSTNKARLDYKKATGKKLKRNQE |
| Ga0181357_12608103 | 3300017777 | Freshwater Lake | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNKARVDYEESTGKTLP |
| Ga0181349_10820421 | 3300017778 | Freshwater Lake | VRIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKAT |
| Ga0181348_12679231 | 3300017784 | Freshwater Lake | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNKARVDYEESL |
| Ga0181359_12668091 | 3300019784 | Freshwater Lake | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDY |
| Ga0207193_13661674 | 3300020048 | Freshwater Lake Sediment | MKIFGPYKGSKQNGGRPIYVFKRKKKDGSTVTTSSNKARVDYEKAT |
| Ga0222713_107913142 | 3300021962 | Estuarine Water | MKIFGPYKGSKQNGGRKIYVFKRKKKDGTTVTTSSNKARVDYEKRT |
| Ga0181354_12196311 | 3300022190 | Freshwater Lake | MKIFGPYKGSKANGERPIYVFKRKKKDGTTTTTSSNKARVDYEKA |
| Ga0196901_11450463 | 3300022200 | Aqueous | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARHEYEESTGKKLPRN |
| Ga0214921_101107555 | 3300023174 | Freshwater | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDFKRATGK |
| Ga0244776_103872981 | 3300024348 | Estuarine | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTTTTSSNKARVD |
| Ga0244776_107590733 | 3300024348 | Estuarine | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTTTTSSNK |
| Ga0255142_10104181 | 3300024352 | Freshwater | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSSNKARVDYEKATGKTLPK |
| Ga0255165_10530181 | 3300024357 | Freshwater | MKIFGPYKGSKQNGGRPIYVFKRRKKNGEVVTTSSNKARVDYEKSTGKTLPR |
| Ga0255272_11728433 | 3300024866 | Freshwater | MIKRFGPYKGSKQNGGRPIYVFKRRKKNGEVVTTSSNKARVD |
| Ga0208161_10471035 | 3300025646 | Aqueous | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTN |
| Ga0208160_100239813 | 3300025647 | Aqueous | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARHEYEES |
| Ga0255156_10257601 | 3300026478 | Freshwater | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSS |
| Ga0209552_10184575 | 3300027563 | Freshwater Lake | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDYKKAT |
| Ga0208960_11611732 | 3300027649 | Freshwater Lentic | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDYKKATGK |
| Ga0208975_11221634 | 3300027659 | Freshwater Lentic | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNKARVDYEEST |
| Ga0208975_11452683 | 3300027659 | Freshwater Lentic | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDYKKATGKKL |
| Ga0209443_11421411 | 3300027707 | Freshwater Lake | VRIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTST |
| Ga0209443_11508441 | 3300027707 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTTTTSTNKARLDYKKATGKKLK |
| Ga0209297_10383576 | 3300027733 | Freshwater Lake | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNKARVDY |
| Ga0209087_12464151 | 3300027734 | Freshwater Lake | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVATTSSNK |
| Ga0209085_11065125 | 3300027741 | Freshwater Lake | MAEVKIGSRKKFGPYKGSEQNGGRPIYVWKVKTKDGWRTESKNKAREDYEQSS |
| Ga0209355_11864773 | 3300027744 | Freshwater Lake | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDYKKATGKKLT |
| Ga0209084_11296521 | 3300027749 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKA |
| Ga0209596_13942822 | 3300027754 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKAT |
| Ga0209500_103561984 | 3300027782 | Freshwater Lake | MTMKSKFGPYKGSEQNGGRPIYVFKKKVAGKTVSTSSNKARVEYKEKTGKTLSKK |
| Ga0209246_102017631 | 3300027785 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVFKRKRKDGSVETTSSNKARVD |
| Ga0209246_103828711 | 3300027785 | Freshwater Lake | MKTKYGPYKGSKQNGGRPIYVFKKKVKGKTVTTSS |
| Ga0209353_103701521 | 3300027798 | Freshwater Lake | MKIFGPYKGSKQNGGRPIFVIKRKKKDGTTETTSTNKARLDYKKATG |
| Ga0209990_102339091 | 3300027816 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKL |
| Ga0255172_10292274 | 3300028103 | Freshwater | MIKRFGPYKGSKQNGGRPIYVFKRRKKNGEVVTTSSNKARVDYEDST |
| Ga0304730_10988035 | 3300028394 | Freshwater Lake | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNK |
| (restricted) Ga0247832_10616445 | 3300028557 | Freshwater | MKRFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSSNKARV |
| Ga0119944_10401863 | 3300029930 | Aquatic | MKRFGPYKGSKQNGGRPIYVFKRKKKDGTTVTTSSNKARVDYE |
| Ga0315899_111542443 | 3300031784 | Freshwater | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARL |
| Ga0315900_105066904 | 3300031787 | Freshwater | MKIFGPYKGSKQNGGRKIYVFKRKKKDGTTVTTSSNKARVDYEKRTGKTL |
| Ga0315900_106163403 | 3300031787 | Freshwater | MGEVKIFGPYKGSKQNGGRPIYVIKRKKKDGSTETTSTNKARLDYKKATGKKLKR |
| Ga0315900_110843471 | 3300031787 | Freshwater | MKKSIKKTIKRIFGPYKGSEQNGGRPIYVIKKRTKDGKVVTTSSNKARVDYEKAT |
| Ga0315909_100983287 | 3300031857 | Freshwater | MIKRFGPYKGSKQNGGRPIYVFKRRKKNGEVVTTSSNKARVDYEDSTGETL |
| Ga0315909_101894374 | 3300031857 | Freshwater | MGEVKIFGPYKGSKQNGGRPIYVIKRKKKDGSTETTSTN |
| Ga0315909_101948271 | 3300031857 | Freshwater | MKKIFGPYKGSKANGGRPIYVFKRKKKDGTVVTTSSNKARVDYEEATGK |
| Ga0315909_102051951 | 3300031857 | Freshwater | VKIFGPYKGSKQNGGRPIYVIKRKKKDGSTQTTSTNKARLDYKKAT |
| Ga0315909_106272363 | 3300031857 | Freshwater | MGEVKIFGPYKGSKQNGGRPIYVIKRKKKDGSTETTSTNKARLDYKKATGKK |
| Ga0315901_111028741 | 3300031963 | Freshwater | MKIFGPYKGSKQNGGRKIYVFKRKKKDGTTVTTSSNKARV |
| Ga0315906_108052934 | 3300032050 | Freshwater | MKIFGPYKGSKQNGGRKIYVFKRKKKDGTTVTTSSNKARVDYERR |
| Ga0315903_105831891 | 3300032116 | Freshwater | MFGPYEGSEQNGGRPIYVFKKKKNGKTVTTSSNKARVE |
| Ga0315903_108548271 | 3300032116 | Freshwater | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKAR |
| Ga0315273_123625053 | 3300032516 | Sediment | MKIFGPYKGSKQNGGRAIYVFKRKRKDGSVETTSSNKARVD |
| Ga0334998_0683029_2_130 | 3300034019 | Freshwater | MIKRFGPYKGSKQNGGRPIYVFKRRKKNGEVVTTSSNKARVDY |
| Ga0335019_0777783_3_146 | 3300034066 | Freshwater | MTMKSKFGPYKGSEQNGGRPIYVFKKKVAGKTVTTSSNKARVEYKEKT |
| Ga0335036_0879950_393_509 | 3300034106 | Freshwater | MKIFGPYKGSKQNGGRPIYVFKRKKKDGTTTTTSSNKAR |
| Ga0335033_0261571_750_902 | 3300034117 | Freshwater | MKIFGPYKGSKQNGGRPIYVIKRKKKDGTTETTSTNKARLDYKKATGKKLK |
| ⦗Top⦘ |