NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091349

Metagenome Family F091349

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091349
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 118 residues
Representative Sequence MKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVNKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Number of Associated Samples 77
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.83 %
% of genes near scaffold ends (potentially truncated) 61.68 %
% of genes from short scaffolds (< 2000 bps) 92.52 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.458 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(25.234 % of family members)
Environment Ontology (ENVO) Unclassified
(76.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.589 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 76.19%    β-sheet: 0.00%    Coil/Unstructured: 23.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00361Proton_antipo_M 50.47
PF06455NADH5_C 1.87
PF01059Oxidored_q5_N 0.93
PF03099BPL_LplA_LipB 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1009Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunitEnergy production and conversion [C] 3.74
COG0095Lipoate-protein ligase ACoenzyme transport and metabolism [H] 0.93
COG0321Lipoate-protein ligase BCoenzyme transport and metabolism [H] 0.93
COG0340Biotin-protein ligaseCoenzyme transport and metabolism [H] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.39 %
UnclassifiedrootN/A5.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000973|BBAY93_10085054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium809Open in IMG/M
3300001954|GOS2235_1011177Not Available906Open in IMG/M
3300001954|GOS2235_1012810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1661Open in IMG/M
3300001958|GOS2232_1048882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium766Open in IMG/M
3300001960|GOS2230_1031813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1512Open in IMG/M
3300001974|GOS2246_10185603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter2216Open in IMG/M
3300002040|GOScombined01_104075924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter2524Open in IMG/M
3300004097|Ga0055584_100187689All Organisms → cellular organisms → Bacteria → Proteobacteria2096Open in IMG/M
3300005510|Ga0066825_10028501All Organisms → cellular organisms → Bacteria → Proteobacteria1946Open in IMG/M
3300005523|Ga0066865_10333527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium574Open in IMG/M
3300005837|Ga0078893_10017339All Organisms → cellular organisms → Bacteria → Proteobacteria841Open in IMG/M
3300005946|Ga0066378_10053372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1259Open in IMG/M
3300005960|Ga0066364_10153782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium789Open in IMG/M
3300007639|Ga0102865_1231355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium551Open in IMG/M
3300009420|Ga0114994_10455870Not Available844Open in IMG/M
3300009472|Ga0115554_1311430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium622Open in IMG/M
3300009526|Ga0115004_10870917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium537Open in IMG/M
3300009550|Ga0115013_10314061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium974Open in IMG/M
3300009593|Ga0115011_11165429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300009593|Ga0115011_12208187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium508Open in IMG/M
3300009790|Ga0115012_10078602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2269Open in IMG/M
3300009790|Ga0115012_11672467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium553Open in IMG/M
3300010883|Ga0133547_10033534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique12566Open in IMG/M
3300010936|Ga0137784_1359469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium670Open in IMG/M
3300012919|Ga0160422_10556575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium725Open in IMG/M
3300012920|Ga0160423_10267747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1180Open in IMG/M
3300012920|Ga0160423_10544583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium788Open in IMG/M
3300012920|Ga0160423_10889015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium598Open in IMG/M
3300012928|Ga0163110_10284397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1204Open in IMG/M
3300012928|Ga0163110_10864913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium714Open in IMG/M
3300012928|Ga0163110_11265732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium594Open in IMG/M
3300012928|Ga0163110_11725170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium511Open in IMG/M
3300012928|Ga0163110_11795400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium500Open in IMG/M
3300012936|Ga0163109_10449986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300012936|Ga0163109_10734548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium722Open in IMG/M
3300012952|Ga0163180_10139953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae1595Open in IMG/M
3300012952|Ga0163180_10991879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium672Open in IMG/M
3300012953|Ga0163179_10300169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1270Open in IMG/M
3300012954|Ga0163111_10719390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria944Open in IMG/M
3300012954|Ga0163111_10748337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria926Open in IMG/M
3300012954|Ga0163111_10754137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium923Open in IMG/M
3300012954|Ga0163111_10977901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria816Open in IMG/M
3300012954|Ga0163111_11113953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium767Open in IMG/M
3300012954|Ga0163111_11174522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium748Open in IMG/M
3300012954|Ga0163111_11223060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300012954|Ga0163111_11410063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium687Open in IMG/M
3300012954|Ga0163111_12539183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium522Open in IMG/M
3300017717|Ga0181404_1162079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium538Open in IMG/M
3300017749|Ga0181392_1030987All Organisms → cellular organisms → Eukaryota1682Open in IMG/M
3300017755|Ga0181411_1130713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium730Open in IMG/M
3300017762|Ga0181422_1023966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1996Open in IMG/M
3300017762|Ga0181422_1094246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium939Open in IMG/M
3300017762|Ga0181422_1137215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium754Open in IMG/M
3300017762|Ga0181422_1225015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium560Open in IMG/M
3300017773|Ga0181386_1252901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium520Open in IMG/M
3300017781|Ga0181423_1096952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1156Open in IMG/M
3300017782|Ga0181380_1324564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium501Open in IMG/M
3300017786|Ga0181424_10068853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1529Open in IMG/M
3300017786|Ga0181424_10088867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1335Open in IMG/M
3300017786|Ga0181424_10335744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium623Open in IMG/M
3300017786|Ga0181424_10398532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium560Open in IMG/M
3300017956|Ga0181580_10821084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium584Open in IMG/M
3300018039|Ga0181579_10688381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium521Open in IMG/M
3300018417|Ga0181558_10281326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium915Open in IMG/M
3300018428|Ga0181568_10463377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1014Open in IMG/M
3300019459|Ga0181562_10530169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium557Open in IMG/M
3300020247|Ga0211654_1003478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2717Open in IMG/M
3300020266|Ga0211519_1087905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium556Open in IMG/M
3300020366|Ga0211489_10153094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium640Open in IMG/M
3300020366|Ga0211489_10201151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium559Open in IMG/M
3300020376|Ga0211682_10099346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1167Open in IMG/M
3300020380|Ga0211498_10282996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium626Open in IMG/M
3300020384|Ga0211596_10201024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium602Open in IMG/M
3300020388|Ga0211678_10200378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium837Open in IMG/M
3300020388|Ga0211678_10222019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium786Open in IMG/M
3300020393|Ga0211618_10265636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium577Open in IMG/M
3300020394|Ga0211497_10299082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium600Open in IMG/M
3300020401|Ga0211617_10477849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium512Open in IMG/M
3300020406|Ga0211668_10259626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium671Open in IMG/M
3300020410|Ga0211699_10315436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium611Open in IMG/M
3300020416|Ga0211644_10279601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium686Open in IMG/M
3300020419|Ga0211512_10295061Not Available736Open in IMG/M
3300020420|Ga0211580_10463619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium512Open in IMG/M
3300020429|Ga0211581_10322023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium630Open in IMG/M
3300020429|Ga0211581_10328905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium623Open in IMG/M
3300020437|Ga0211539_10298308Not Available668Open in IMG/M
3300020438|Ga0211576_10408852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium693Open in IMG/M
3300020441|Ga0211695_10218232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium679Open in IMG/M
3300020455|Ga0211664_10548090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium525Open in IMG/M
3300020463|Ga0211676_10565461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium590Open in IMG/M
3300020463|Ga0211676_10580853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium579Open in IMG/M
3300020468|Ga0211475_10544219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium553Open in IMG/M
3300020469|Ga0211577_10395245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium855Open in IMG/M
(restricted) 3300023109|Ga0233432_10089525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1767Open in IMG/M
3300023170|Ga0255761_10308475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium825Open in IMG/M
3300024248|Ga0228676_1077401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium737Open in IMG/M
(restricted) 3300024264|Ga0233444_10351967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium621Open in IMG/M
3300024322|Ga0228656_1133983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium517Open in IMG/M
3300025892|Ga0209630_10059723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2223Open in IMG/M
3300025897|Ga0209425_10358030Not Available710Open in IMG/M
3300031774|Ga0315331_11137535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium523Open in IMG/M
3300031851|Ga0315320_10580841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium740Open in IMG/M
3300032011|Ga0315316_11261493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium591Open in IMG/M
3300032047|Ga0315330_10099382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1925Open in IMG/M
3300032073|Ga0315315_10284079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium1542Open in IMG/M
3300032073|Ga0315315_11673664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium545Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.23%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater17.76%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater14.02%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.21%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.61%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.61%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.80%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.80%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.87%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.93%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.93%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.93%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001954Marine microbial communities from Colon, Panama - GS019EnvironmentalOpen in IMG/M
3300001958Marine microbial communities from Gulf of Mexico, USA - GS016EnvironmentalOpen in IMG/M
3300001960Marine microbial communities from South of Charleston, South Carolina, USA - GS014EnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005946Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_AEnvironmentalOpen in IMG/M
3300005960Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_AEnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010936Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15mEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020247Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962)EnvironmentalOpen in IMG/M
3300020266Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)EnvironmentalOpen in IMG/M
3300020366Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146)EnvironmentalOpen in IMG/M
3300020376Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020384Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020393Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020401Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)EnvironmentalOpen in IMG/M
3300020406Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020416Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020429Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020455Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023170Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaGEnvironmentalOpen in IMG/M
3300024248Seawater microbial communities from Monterey Bay, California, United States - 48D_rEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY93_1008505413300000973Macroalgal SurfacePKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
GOS2235_101117713300001954MarineFANFLSKIKFFDELSTNKLETSIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVSKIINEVKLKIKLKLFFINTPIIKIENIDKVKKISGSNIFKLFIILI*
GOS2235_101281033300001954MarineMPKIESNIIIGYSNFDNFLSKIKFFDELSTNKLEIKIKILKKFEKASRVKLSKNIFSTLFGLFKIIAIVSKIINELKLKIKLKLFLMNTPIIKIENIERVKKISGSNIFKLFIILF*
GOS2232_104888213300001958MarineKIESNIIIGYSNFANFLSKIKFFDELSTNKLETSIRILKKFEKESLVKLSKNIFSTLFELFKIIAMVNKIINEVKLKIKLKLFLINTPIIKIENIDRVKKISGSNIFKLFIILI*
GOS2230_103181333300001960MarineSNFANLLSKIKFFEELSTNKLEMSIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVNKIISEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
GOS2246_1018560313300001974MarineLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVRLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
GOScombined01_10407592413300002040MarineERRIIIGYSNFPILLSIIKTLDVLRTNKLAIKIKILKKFEKESLVKLSKNIFSVSFELFKIIAIVKRIIAELKLKIKLKLSLIKTPIIKIEKIDKVKNISGSKIFKLFNILFYSFRTYCHFIVAN*
Ga0055584_10018768933300004097Pelagic MarineNIPKIDNKIIIGYSNFDNLLSMIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFNIMVMVNIIINELKLKIKLKLFFINTPIIKIKNIDKVKKSSGSNIFKLFIILV*
Ga0066825_1002850113300005510MarineLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILF*
Ga0066865_1033352723300005523MarineANFLSKIKFLEELSTNKLERSIKILKKLEKASLVKLSKNIFSTLFELLKIMAMVNKIINELRLKIKLKLFFTNTPIIKIENMDKVKKISGSNTFKLFIILVKTNCFYICLIIIN*
Ga0078893_1001733923300005837Marine Surface WaterMKNIPKIDNKIIIGYSNFANLLSRIKFFDELRTNKLETSIKILKKLEKASRMKLSKNIFSILFELFIIIAMVNKIINELRLKIKLKLFFINTPIIKMENIDRVKKISGS
Ga0066378_1005337213300005946MarineMKNIPKIESNIIIGYSNFANLLSKIKFFEELSTNKLEMSIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVNKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0066364_1015378223300005960MarinePKIEIKIIIGYSNFDNLLSKMNFFDELSTKKLEIRINTLKKFEKASLVKLSKNIFSTLFELLKIMAMVNKIINELKLKIKLKLFFKNTPIIKIENIERVKKISGSNIFKLFIMLI*
Ga0102865_123135513300007639EstuarineMGYSNLSNFLSVIYFLDVFKTNKLEISIKILKKFENASLVKLSKKIFSSIFGLLKIIAAVIIIIIEDKLNIKLKLFFKKTPIINKEKIDNVKKISGSNIFKLLIILI*
Ga0114994_1045587023300009420MarineLLSIIKCFDMFKTNKLETSIKILKKFEKGSLIKLSKNIFSSLFELLNIIAIVNIIINKERLKIKLKLFFTKTPIIKIEKIDNVKKISGSKIFKLLIILIKSVNFYGNFVIAN*
Ga0115554_131143023300009472Pelagic MarineMISLELTIKNIPKIESKIMIGYSNLSNLLSRIKFFDEFSTNRLDISIKILKKFENGSLVKLSRNIFSSLFELLKIIAIVNIIINEVKLNIKLKLFFVKTPTIKMEKIDKVKKISGNKIFKLLIISVYPAILNSNFIIIN*
Ga0115004_1087091713300009526MarineMISFELTIKNIPKIESKTMIGYSNLSNLLSRINFFDEFRTKRLEISIKILKKFENGSLVKLSRNIFSSLFELLNIIAIVNIIINEVRLNIKLKLFFVKTPTIKIKKIDKVKKISGNKIFKLLIILVYPGILNSNFIIIN*
Ga0115013_1031406123300009550MarineMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASREKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFINTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0115011_1116542923300009593MarineMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIATVIKIINEVKLKIKLKLFFMNTPSIKIENIDNVKKISGSNIFKLFIILI*
Ga0115011_1220818723300009593MarineIIIGYSNFANFLSKMKFFDELSTNKLEISIKILKKFEKASRVKLSKNIFSALFELFKIIAMVTRIINELKLKIKLKLFFMNTPIIKIENIDKVKKISGSNIFKLFIILV*
Ga0115012_1007860223300009790MarineMKNIPKIDSNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRVKLSKNIFSRLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFNILI*
Ga0115012_1167246723300009790MarineGYSNLANFISKIKFFDELSTNKLETSIKILKKLEKASRVKLSKNIFSTLFELFKIMAMVNKIINELRLKIKLKLFLINTPIIKIENMDKVKKISGSKIFKLFIILV*
Ga0133547_1003353493300010883MarineMISFELTIKNIPKIESKTMIGYSNLSNLLSRINFFDEFRTKRLEISIKILKKFENGSLVKLSRNIFSSLFELLKIIAIVNIIINEVRLNIKLKLFFVKTPTIKIKKIDKVKKISGNKIFKLLIILVYPSILNSNFIIIN*
Ga0137784_135946923300010936MarineMPNIESNITIGYSNFANFLSKIKFFDELSANKLDKSIKILKKLEKASRVKLSKNIFSTLFGLFKIMAIVNIIINELKLKTKLKLFLINTPIIKMEKIDNVKKISGSNIFKLSIILI*
Ga0160422_1055657523300012919SeawaterESNIIIGYSNFANFLSKIKFLEELSTNKLETSIKILKKLEKASLVKLSKNIFSTLFELLKIMARVNKIINELRLKIKLKLFLTNTPTIKTENIDKVKKISGSKIFKLFIMLF*
Ga0160423_1026774723300012920Surface SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIATVIKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILV*
Ga0160423_1054458313300012920Surface SeawaterKIISLELTMKNIPKIESNIIIGYSNFANLLSKIKFFDELITNKLEISINILKKFEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0160423_1088901513300012920Surface SeawaterGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINDVKLKIKLKLFLINTPIIKIENIDSVKKISGSNIFRLFIILI*
Ga0163110_1028439723300012928Surface SeawaterMPKIESNIIIGYSNFANFKSKIKFFDELSANKLEISIKILKKLEKESRIKLSKNIFSTSLEPFKIIAIVNIIISELKLKIKLKLFFMNTPNIKIKNIDKVKKISGSNIFKLFIILF*
Ga0163110_1086491313300012928Surface SeawaterISFELTIKNMPKIESNIIIGYSNFDSLLSKIKFFDELSTNKLEIRIKILKKFEKASRVKLSKNIFSSLFGLFKIIAIVSKIISELKLKIKLKLFLINTPIIKIENIDKVKKISGSNIFKLFTILF*
Ga0163110_1126573213300012928Surface SeawaterNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRVKLSKNIFSTLLELFNIIAIVNKIINEVKLKIKLKLFFINTPIIKIENIERVKNISGSNIFKLFIILI*
Ga0163110_1172517013300012928Surface SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIISEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNI
Ga0163110_1179540013300012928Surface SeawaterMSLELTMKNMPKIERRIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRTKLSENIFSTLFGLFKIIAIVTKIINELKLNIKLKLFFMNTPIIKTENIDRVKKISGSNTFKLFIILI*
Ga0163109_1044998623300012936Surface SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIATVNKIINEVRLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0163109_1073454823300012936Surface SeawaterMKNIPKIDSNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0163180_1013995323300012952SeawaterMKNIPKIEIRIIIGYSNLFNLLSSIKFFDEFKTNKLEISIKILKKLENLSLTKLSKNIFSVSLVLLKMIAIVITIIKDERLKIKLKLFLIKTPIIKIANIDKDRKISGSNIFKILIINFETYLKLDLIDNLKVNY*
Ga0163180_1099187923300012952SeawaterMKNMPKIESNIIIGYSNFANLLSKIKFFDELSTNKLETSIKILKKLEKASRVKLSKNIFSTLFEPFKIIATVIKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0163179_1030016923300012953SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIATVIKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSSIFKLFIILV*
Ga0163111_1071939023300012954Surface SeawaterMPKIDSNTIIGYSNFPNLLSKIKFFDEFSTNKLEISINTLKKFEKASRAKLSKNIFSVLFELFKIMAIVNKIINELKLKIKLKLFLIKTPIIKIENIDKVKKISGSSIFKLFII*
Ga0163111_1074833723300012954Surface SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIAIVIKIIIEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0163111_1075413713300012954Surface SeawaterMSLELTIKNIPKIESNIIIGYSNFANLLSKIKFLDELSTNKLATSIKILKKLEKASRTKLSRNIFSSVLGLFKIMTMVNKIISELRLKIKLKLFLINTPIIKIENIDKVKKISGNNIFKLFIILVKTNCF*
Ga0163111_1097790123300012954Surface SeawaterMKNMPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRMKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI*
Ga0163111_1111395323300012954Surface SeawaterMKNMPKIERRIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRTKLSENIFSTLFGLFKIIAIVTKIINELKLNIKLKLFFMNTPIIKMENIDRVKKISGSNIFKLLIILI*
Ga0163111_1117452223300012954Surface SeawaterTIKNIPKIESNIIIGYSNFANFLSKIKFFDELSTNKLETSIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINEVKLKIKLKLFFMNTPIIKIENIDKVKKISGSNIFKLFIILI
Ga0163111_1122306023300012954Surface SeawaterMKNMPKIESNIIIGYSNLANFISKIKFFDELSTNKLETSIKILKKLEKASRVKLSKNIFSTLFELFKIMAMVNKIINELRLKIKLKLFLINTPIIKIENMDKVKKISGSKIFKLFIILV*
Ga0163111_1141006313300012954Surface SeawaterMKNIPNIDSNIIIGYSNFANLLSKIKFFDELSTNKLEVSINILKKFEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFK
Ga0163111_1253918323300012954Surface SeawaterKIDNKIIIGYSNFANLLSKIKFLEELSTNKLEISIKTLKKFEKASRVKLSRNIFSVSLGLFKIIAIVNKIINELKLKIKLKLFFRKTPIIKIENIDRVKKISGSNIFKLFIISVKTTCFNSRFIIID*
Ga0181404_116207913300017717SeawaterMKNMPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEIRIKILKKFEKASRVKLSKNIFSTLFEPFKIIAIVSKIINELKLKIKLKLFLMNTPIIKIENIDKVKKISGSNIFKLFIILFKTICLHSYFVIIDQIKNLKDVNKSELIMLGIL
Ga0181431_113298823300017735SeawaterMIMGYSNLFILLSIIKFFDEFKTNKLEISINILKKFENESLEKLSRNIFSVLLVELKIIAIVIKIIIEVELKTKLKLFLVNTPIIKTLKIDNAKKISGNNIFK
Ga0181392_103098713300017749SeawaterFANLLSKIKFFDELSTNRLDNRIKILKKFEKASRVKLSKNIFSTLFELLKIIAMVNKIINELKLNIKLKLFFINTPIIKIENIERVKKISGSNILRLFIISI
Ga0181411_113071313300017755SeawaterSLELTMKNMPKIESNIIIGYSNFANLLSKIKFFDELSTNRLDNRIKILKKFEKASRVKLSKNIFSTLFELFKIIAIVNKIINELKLKIKLKLFFMNTPIIKIENIDRVKKISGSNIFKLFIILF
Ga0181422_102396613300017762SeawaterKIISLELTMKNIPKIDSKIIIGYSNFANLLSKIKFFEELRTNKLETSIKILKKLEKASRVKLSKNIFSTLFELLKIIAIVNKIINEVKLKIKLKLFFMNTPIIKTENIVKVRKISGSNIFKLFIILI
Ga0181422_109424613300017762SeawaterKNIPKIDNKIIIGYSNFANLLSRIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFELFKIIAIVNNIINELRLNIKLKLFFMNTPIIKIENIDSVKKISGSNIFRLFVILI
Ga0181422_113721523300017762SeawaterGYSNFANLLSKIKFFDELSTKKLETRINILKKFEKASRVKLSKNIFSTLVELFNIIAIVNKIINELKLKIKLKLFFINTPIIKMENIDKVKKISGSNIFKLFNILI
Ga0181422_122501523300017762SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIATVIKIINEVKLKIKLKLFFMNTPSIKIENIDSVKKISGSNMFKLYIILI
Ga0181386_125290123300017773SeawaterMSLELTMKNIPKIESKIIIGYSNFPNLLSIIKALDELRTNKLEISIKILKKFEYASLEKLSKNIFSELLELLNIIAIVTRIIIELKLKIRLKLFLIKTPIIKAEKIDIVK
Ga0181423_109695223300017781SeawaterMKNMPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEIRIKILKKFEKASRVKLSKNIFSTLFEPFKIIAIVSKIINELKLKIKLKLFLINTPIIKIENMDRVKKISGSNIFKLFIMLI
Ga0181380_132456413300017782SeawaterMPKIESRIIIGYSNLDNLLSXIKFFDELSTNKLETSIKILKKLEKASRVKLSKNIFSTLFEPFKIMAIVNNIINELKLKIKLKLFFIKTPIIKIENIDKVKKISGSNIFKLFIILF
Ga0181424_1006885313300017786SeawaterELTIKNIPKIDNKIIIGYSNFANLLSWIKFFDELRTNKLETSIKILKKFEKASRIKLSKNIFSKLFELLRIIAIVSKIINELKLKIKLKLSFIKTPIIKIENIDKVKKISGSNIFRLFIILV
Ga0181424_1008886713300017786SeawaterIISFALTIKNIPKIESKIMIGYSNFPNLLSIIKFLDAFKTKKLETSIKILKKFENASLIKLSKNIFSSMLELFKRMPMVNNIINELKLKIRLKLFFVNTPIIKIEKIDKVKNISGSKIFKLFIISVYSACSDCYFIVVD
Ga0181424_1033574413300017786SeawaterIIIGYSDFANLLSKIKVFDELSTNKLEISIKILKKLEKASRVKLSKKIFSTLFELFKIIPIVSKIIKELKLKIKLKLFFTNTPIIKIEKIEKVKKISGSNIYKLFTILI
Ga0181424_1039853213300017786SeawaterMPKIESKIIIGYSNFDNLLSWIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSILFELFKIMAMVSKIISELKLKIKLKLFFVKTPIIKIENID
Ga0181580_1082108423300017956Salt MarshELTMKNIPKIESNIIIGYSNFPNLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIAIVIKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Ga0181579_1068838123300018039Salt MarshIKNIPKIERRIIIGYSNFLILLSIIKTLDVFRTNKLAIKIKILKKFEKESLVKLSKNIFSVSFELFTIIAIVKRIIAELKLKIKLKLSLIKTPIIKTEKIDKVKNISGSKILKLFNILFYFFRTNCHFIVG
Ga0181558_1028132613300018417Salt MarshMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASREKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFNILI
Ga0181568_1046337723300018428Salt MarshMKNIPKIDSNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRAKLSKNIFSTLFELFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Ga0181562_1053016913300019459Salt MarshISLELTMKNIPKIESNIIIGYSNFANLLSTIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSSIFKLFIILV
Ga0211654_100347833300020247MarineIISLELTIKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKLEKASRVKLSKNIFSTLFEPFKIIATVIKIINEVKLKIKLKLFFMNTPIIKMEKIDNVKKISGSNIFKLFIILI
Ga0211519_108790523300020266MarineMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSKLFEVFKIITTVKKIINEQRLKIKLKLFFMNTPIIKMEKIDNVKKISGSNIFKLFIILI
Ga0211489_1015309413300020366MarineNNIISLELTIKNIPKIESNIIIGYSNFANFISKIKFFDELSTNKLEISIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINDVKLKIKLKLFLINTPIIKIENIDSVKKISGSNIFRLFIILI
Ga0211489_1020115113300020366MarineMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Ga0211682_1009934613300020376MarineGYSNLSKLFSVMKLFEEFRTNKLEISIKILKKFEKESLVKLSKNIFSSLFGLLKIIAIVNKIIREVRLKIKLKLFCVKTPIIKMLKIDKVRKISGNSMLKLFIIFLIFQIFNSDFVIIN
Ga0211498_1028299613300020380MarineSNIIIGYSNFANFISKIKFFDELSTNKLEISIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINDVKLKIKLKLFLINTPIIKIENIDSVKKISGSNIFRLFIILI
Ga0211596_1020102423300020384MarineMISLELTMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINDVKLKIKLKLFLINTPIIKIENIDSVKKISGSNIFRLFIILI
Ga0211678_1020037823300020388MarineMKNIPKIESKIIIGYSNFANFLSKIKFFDELSTNKLDIRINILKKFEKASRVKLSKNIFSSLFELFKSIAIVNKIINELKLKIKLKLFFINTPIIKIENIDRVKKISGSNIFKLFIILV
Ga0211678_1022201913300020388MarineRIDSRIIIGYSNFANLLSKIKFFEELRTNKLETSIKILKKLEKASRVKLSKNIFSTLFELFKIIEIVNKIINEVKLKIKLKLFFMKTPIIKTENIDRVKKISGSNIFKLFIILI
Ga0211618_1026563623300020393MarineNFLSKIKFLDELSTNKLETSIKILKKLEKASLVKLSKNIFSTLLELFKIKTMVDKIINELKLKIKLKLFLTNTPIIKIENMDKVKKISGSNIFKLFIILV
Ga0211497_1029908213300020394MarineIPKIESNIIIGYSNFANFISKIKFFDELSTNKLEISIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINDVKLKIKLKLFLINTPIIKIENIDSVKKISGSNIFRLFIILI
Ga0211617_1047784913300020401MarineMKNIPKIDSNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKFEKESRMKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Ga0211668_1025962613300020406MarineFELTIKNIPKIESNIIIGYSNFANFLSKIKFFDELSTNKLEISIKILKKFEKASLVKLAENIFSSLLELFKIIAMVNKIINELRLKIKLKLFFMNTPIIKIENIDRVKKISGSNIFKSFIILI
Ga0211699_1031543613300020410MarineKNIPKIESKIIIGYSNFAKFLSKIKFFDELSTNKLETSIKILKKLEKASRIKLSKNIFSTLFGLFKIMAMVNKIISELRLKIKLKLFLINTPIIKIENMDKVKKISGSNIFKLFIMLIKINCFYISLIIIN
Ga0211644_1027960113300020416MarineMPKIERRIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRTKLSENIFSTLFGLFKIIAIVTKIINELKLNIKLKLFFMNTPIIKMENIDRVKKISGSNIFKLLIILI
Ga0211512_1029506123300020419MarineANLLSKIKFFDELSTNKLEIRINILKKFENASRVKLSKNIFSTSFGLFKIIAIVNKIIIELKLKIKLKLFFMNTPIIKIENIDRVKNISGNNIFKLFIILI
Ga0211580_1046361923300020420MarineFANFLSKIKFFDELSANKLDKSIKILKKLEKASRVKLSKNIFSTLFGLFKIMAIVNIIINELKLKTKLKLFLINTPIIKMEKIDNVKKISGSNIFKLSIILI
Ga0211581_1032202323300020429MarineMKNIPKIDNKIIIGYSNFANLLSRIKFFEELSTNKLEISIKILKKLEKESRIKLSKNIFSTSLEPFKIIAIVNIIISELKLKIKLKLFFMNTPNIKIKNIDKVKKISGSNI
Ga0211581_1032890523300020429MarineELTIKNMPKIESSIIIGYSNFAILLSNIKFFDELRTNKLDKSMRILKKFEKASRVKLSKNIFSSLFELFKIMATVSKIISELKLNIKLKLFCIKTPIIKIENIDKVKKISGSSIFKLFNIYFF
Ga0211539_1029830813300020437MarineANFISKIKFFDEFSTNKLEISIKILKKLEKESLVKLSKNIFSTLFELFKIMAMVNKIINDVKLKIKLKLFLINTPIIKIENIDSVKKISGSNIFRLFIILI
Ga0211576_1040885213300020438MarineMPNIEINIIIGYSNFANLLSKIKFFDELSTNRLDNRIKILKKFEKASRVKLSKNIFSTLFELFKIIAIVNKIINELKLKIKLKLFFMNTPIIKIENIDRVKKISGSNIFKLFIILF
Ga0211695_1021823223300020441MarineKIRSFELNIKNIPRIEIKIIIGYSNLLTLLSTIKFFDELSTNKLAISINTLKKLEKVSLIKLSRKILVSSVGEFKIINIVITNITEDKLKTKLKLLFKNTPIIKIKKIDKVKKISGNNMFKLLIIIY
Ga0211664_1054809023300020455MarineRIIIGYSNLFNLLSIIKFFDEFSTNKLETSISTLKKFENGSFIKASRNILSVTLIEFKIIAIVPMMIIDVKLKIKLKLLLINTPSIKILKIDNVKKISGNNIYKLLIILS
Ga0211676_1056546113300020463MarineKIIIGYSNFPNLLSIIKVLDELRTNKLEISIKILKKFEKASLEKLSKNIFSELLELLIIIAIVTRIIIELKLKIRLKLFLIKTPIIKAEKIDITKNISGSSISRLFIIN
Ga0211676_1058085313300020463MarineMKNIPKIESNIIIGYSNFANFLSKIKFFDELSTNKLEISINILKKFEKASRVKLSKNIFSTLFELFKIIAIVNKIINELKLKIKLKLFFMNTPIIKTENIDRVKKISGSNIFKLFIILF
Ga0211475_1054421913300020468MarineESNIIIGYSNFANLLSKIKFFDELSTNKLDARIKILKKFEKASRVKLSRNIFSTLFELFKIIAMVNKIINELKLNIKLKLFFINTPIIKIENIDRVKKISGSNIFKLFIILI
Ga0211577_1039524523300020469MarineLTMKNMPKIESKIIIGYSNFDNLLSWIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSILFELFKIMAMVSKIISELKLKIKLKLFFVKTPIIKIENIDKVKKISGSNIFKLFIIL
(restricted) Ga0233432_1008952523300023109SeawaterSKTIIGYSNFAKLLSIIKVFDEFKTKKLEESISILKKFEKASLVKLSKNIFSMLFEPFKIIAIVNIIINKDKLKTKLKLFLIKTPIIKIEKIDIVKNISGSKILKLLNTLIYPTILNGNRIIIN
Ga0255761_1030847523300023170Salt MarshMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISINILKKFEKASRVKLSKNIFSTLFEPFKIIAIVRKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Ga0228676_107740123300024248SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVSKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILIKTICLHSCFVIINQIIH
(restricted) Ga0233444_1035196713300024264SeawaterKIESNIIIGYSNFANLLSKIKFFDELRTNKLETKIKILKNFEKRSLVKLSKNIFSTSFELLKIIAIVNKIINELKLKIKLKLFFINTPIIKIENIDKVKKISGSNIFKLFIILI
Ga0228656_113398313300024322SeawaterMGYSNFANLLSKIKFLDELSTNKLEARIIILKKFEKASRVKLSKNIFSTLFELFKIIAMVNIIINELRLNIKLKLFFINTPIIKIEKIDKVKKISGSNIFKLFIIL
Ga0209630_1005972333300025892Pelagic MarineLTIKNIPKIESKIMIGYSNFANFLSMIKFFDAFKTKKLEISIKILKKFENVFLIKLSKKIFSSLPELFNIIVIVSNIISKVKLNIKLKLFLMKTPSIKIKKIDNVKKISGNKIFKLFNILIYTSILNGDFIIIN
Ga0209425_1035803023300025897Pelagic MarineMIGYSNFANFLSMIKFFDAFKTKKLEISIKILKKFENVFLIKLSKKIFSSLPELFNIIVIVSNIISKVKLNIKLKLFLMKTPSIKIKKIDNVKKISGNKIFKLFNILIYTSILNGDFIII
Ga0315331_1113753523300031774SeawaterISFELTIKNIPKIESKTIIGYSNFAKLLSIIKFFDEFKTKKLEESIRILKKFEKASLVKLSKNIFSMLFEPFKIIAIVNIIIINVKLKTKLKLFLIKTPIIKIEKIDIVKNISGSKILKLLNILIYPAILNGNRIIIN
Ga0315320_1058084123300031851SeawaterMKNIPKIESNIIIGYSNFANLLSKIKFFDELSTNKLEISIKILKKLEKASRVKLSKNIFSTLFEPFKIIAIVNKIINEVKLKIKLKLFFMNTPIIKIENIDNVKKISGSNIFKLFIILI
Ga0315316_1126149323300032011SeawaterMPKIESNIIIGYSNFANFLSNIKFFEELSTNKLEASIKILKKLEKASRVKLSKNIFSSLFELFKIIAMVNKIINELRLKIKLKLFFMNTPIIKMENIDRVKKISGSNIFKLFIILI
Ga0315330_1009938223300032047SeawaterMKNIPKIDSKIIIGYSNFANLLSKIKFFEELRTNKLETSIKILKKLEKASRVKLSKNIFSTLFELLKIIAIVNKIINEVKLKIKLKLFFMNTPIIKTENIVKVRKISGSNIFKLFIILI
Ga0315315_1028407923300032073SeawaterNNIISLALTIKNMPKIESNIIIGYSNFANFLSNIKFFEELSTNKLEASIKILKKLEKASRVKLSKNIFSSLFELFKIIAMVNKIINELRLKIKLKLFFMNTPIIKMENIDRVKKISGSNIFKLFIILI
Ga0315315_1167366423300032073SeawaterIISLELTIKNIPKIESNIIIGYSNFANLISKIKFFDEFSTNKLEIRIKILKKFEKASRVKLSKNIFSSLFELFKIITIVSKIINELKLKIKLKLFLMKTPIIKIENIDRVKKISGSNMFKLFIILFLIICLHSCLVIIYQVIDRHV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.