| Basic Information | |
|---|---|
| Family ID | F091251 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LSLTEIMRALQDFGTFIVIILLAYVVYKAAILLEAMSNRIKGEKD |
| Number of Associated Samples | 28 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 54.21 % |
| % of genes near scaffold ends (potentially truncated) | 18.69 % |
| % of genes from short scaffolds (< 2000 bps) | 54.21 % |
| Associated GOLD sequencing projects | 24 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (71.963 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment (35.514 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.075 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (39.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF09826 | Beta_propel | 43.93 |
| PF00579 | tRNA-synt_1b | 3.74 |
| PF03484 | B5 | 2.80 |
| PF13662 | Toprim_4 | 1.87 |
| PF08240 | ADH_N | 1.87 |
| PF02771 | Acyl-CoA_dh_N | 0.93 |
| PF13185 | GAF_2 | 0.93 |
| PF01656 | CbiA | 0.93 |
| PF01036 | Bac_rhodopsin | 0.93 |
| PF00142 | Fer4_NifH | 0.93 |
| PF01409 | tRNA-synt_2d | 0.93 |
| PF01012 | ETF | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF00881 | Nitroreductase | 0.93 |
| PF07690 | MFS_1 | 0.93 |
| PF02018 | CBM_4_9 | 0.93 |
| PF00977 | His_biosynth | 0.93 |
| PF01636 | APH | 0.93 |
| PF08704 | GCD14 | 0.93 |
| PF01546 | Peptidase_M20 | 0.93 |
| PF08494 | DEAD_assoc | 0.93 |
| PF06418 | CTP_synth_N | 0.93 |
| PF04055 | Radical_SAM | 0.93 |
| PF04930 | FUN14 | 0.93 |
| PF13847 | Methyltransf_31 | 0.93 |
| PF13561 | adh_short_C2 | 0.93 |
| PF01037 | AsnC_trans_reg | 0.93 |
| PF00497 | SBP_bac_3 | 0.93 |
| PF00106 | adh_short | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 3.74 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 3.74 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 2.80 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.93 |
| COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 0.93 |
| COG1348 | Nitrogenase ATPase subunit NifH/coenzyme F430 biosynthesis subunit CfbC | Coenzyme transport and metabolism [H] | 0.93 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.93 |
| COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.93 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.93 |
| COG2383 | Uncharacterized membrane protein, Fun14 family | Function unknown [S] | 0.93 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG5524 | Bacteriorhodopsin | Signal transduction mechanisms [T] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.77 % |
| Unclassified | root | N/A | 25.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001751|JGI2172J19969_10002852 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 7765 | Open in IMG/M |
| 3300001751|JGI2172J19969_10005518 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 5473 | Open in IMG/M |
| 3300001751|JGI2172J19969_10015230 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2975 | Open in IMG/M |
| 3300001751|JGI2172J19969_10026886 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2089 | Open in IMG/M |
| 3300001752|JGI2173J19968_10000264 | All Organisms → cellular organisms → Archaea | 18694 | Open in IMG/M |
| 3300001752|JGI2173J19968_10219525 | Not Available | 526 | Open in IMG/M |
| 3300001782|WOR52_10005227 | All Organisms → cellular organisms → Archaea | 19266 | Open in IMG/M |
| 3300001782|WOR52_10010547 | All Organisms → cellular organisms → Archaea | 10774 | Open in IMG/M |
| 3300001782|WOR52_10020767 | All Organisms → cellular organisms → Archaea | 6977 | Open in IMG/M |
| 3300001854|JGI24422J19971_10171475 | All Organisms → cellular organisms → Archaea | 982 | Open in IMG/M |
| 3300001854|JGI24422J19971_10183839 | All Organisms → cellular organisms → Archaea | 931 | Open in IMG/M |
| 3300001854|JGI24422J19971_10201260 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 867 | Open in IMG/M |
| 3300001854|JGI24422J19971_10231260 | All Organisms → cellular organisms → Archaea → TACK group | 779 | Open in IMG/M |
| 3300001854|JGI24422J19971_10239507 | All Organisms → cellular organisms → Archaea | 759 | Open in IMG/M |
| 3300001854|JGI24422J19971_10254664 | Not Available | 724 | Open in IMG/M |
| 3300001854|JGI24422J19971_10305676 | Not Available | 632 | Open in IMG/M |
| 3300001854|JGI24422J19971_10362530 | All Organisms → cellular organisms → Archaea | 561 | Open in IMG/M |
| 3300002053|SMTZ23_10071195 | All Organisms → cellular organisms → Archaea | 5095 | Open in IMG/M |
| 3300003332|GBSed_10009553 | All Organisms → cellular organisms → Archaea | 8728 | Open in IMG/M |
| 3300009034|Ga0115863_1018528 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 9570 | Open in IMG/M |
| 3300009034|Ga0115863_1022289 | Not Available | 8622 | Open in IMG/M |
| 3300009034|Ga0115863_1067844 | Not Available | 4520 | Open in IMG/M |
| 3300009034|Ga0115863_1089932 | All Organisms → cellular organisms → Bacteria | 3847 | Open in IMG/M |
| 3300009034|Ga0115863_1173335 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2620 | Open in IMG/M |
| 3300009034|Ga0115863_1183151 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 2535 | Open in IMG/M |
| 3300009034|Ga0115863_1190025 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 2481 | Open in IMG/M |
| 3300009034|Ga0115863_1206387 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2364 | Open in IMG/M |
| 3300009034|Ga0115863_1263095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2046 | Open in IMG/M |
| 3300009034|Ga0115863_1368502 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1673 | Open in IMG/M |
| 3300009034|Ga0115863_1453540 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1476 | Open in IMG/M |
| 3300009034|Ga0115863_1666803 | All Organisms → cellular organisms → Archaea | 1169 | Open in IMG/M |
| 3300009034|Ga0115863_1784019 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1061 | Open in IMG/M |
| 3300009150|Ga0114921_10231530 | All Organisms → Viruses → Predicted Viral | 1300 | Open in IMG/M |
| 3300009150|Ga0114921_10321630 | All Organisms → cellular organisms → Archaea | 1107 | Open in IMG/M |
| 3300009150|Ga0114921_10825903 | All Organisms → cellular organisms → Archaea | 688 | Open in IMG/M |
| 3300009150|Ga0114921_11018317 | All Organisms → cellular organisms → Archaea | 618 | Open in IMG/M |
| 3300009488|Ga0114925_10776042 | Not Available | 688 | Open in IMG/M |
| 3300009528|Ga0114920_10012688 | Not Available | 4554 | Open in IMG/M |
| 3300010324|Ga0129297_10306771 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 714 | Open in IMG/M |
| 3300010324|Ga0129297_10504230 | Not Available | 532 | Open in IMG/M |
| 3300010324|Ga0129297_10547167 | Not Available | 505 | Open in IMG/M |
| 3300010328|Ga0129298_10049074 | All Organisms → cellular organisms → Archaea → TACK group | 2012 | Open in IMG/M |
| 3300010328|Ga0129298_10124108 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1220 | Open in IMG/M |
| 3300010328|Ga0129298_10127787 | Not Available | 1200 | Open in IMG/M |
| 3300010328|Ga0129298_10132306 | All Organisms → cellular organisms → Archaea | 1178 | Open in IMG/M |
| 3300010328|Ga0129298_10279245 | Not Available | 773 | Open in IMG/M |
| 3300010328|Ga0129298_10398266 | Not Available | 632 | Open in IMG/M |
| 3300010328|Ga0129298_10455261 | Not Available | 584 | Open in IMG/M |
| 3300014886|Ga0180300_10003951 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 7014 | Open in IMG/M |
| 3300022204|Ga0224496_10041670 | All Organisms → cellular organisms → Archaea → TACK group | 2124 | Open in IMG/M |
| 3300022204|Ga0224496_10305533 | Not Available | 650 | Open in IMG/M |
| 3300022205|Ga0224511_10255585 | All Organisms → cellular organisms → Archaea | 1550 | Open in IMG/M |
| 3300022221|Ga0224506_10017919 | All Organisms → cellular organisms → Archaea | 3869 | Open in IMG/M |
| 3300022551|Ga0212089_10141122 | All Organisms → cellular organisms → Archaea | 1239 | Open in IMG/M |
| 3300024263|Ga0209978_10035549 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2488 | Open in IMG/M |
| 3300027888|Ga0209635_10004483 | All Organisms → cellular organisms → Archaea | 10956 | Open in IMG/M |
| 3300027888|Ga0209635_10009895 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 7536 | Open in IMG/M |
| 3300027888|Ga0209635_10047999 | All Organisms → cellular organisms → Archaea | 3479 | Open in IMG/M |
| 3300027888|Ga0209635_10075615 | Not Available | 2754 | Open in IMG/M |
| 3300027888|Ga0209635_10087686 | All Organisms → cellular organisms → Archaea | 2549 | Open in IMG/M |
| 3300027888|Ga0209635_10238258 | Not Available | 1466 | Open in IMG/M |
| 3300027888|Ga0209635_10639985 | Not Available | 788 | Open in IMG/M |
| 3300027888|Ga0209635_10705592 | All Organisms → cellular organisms → Archaea | 737 | Open in IMG/M |
| 3300027888|Ga0209635_11140652 | Not Available | 525 | Open in IMG/M |
| 3300027893|Ga0209636_10000353 | All Organisms → cellular organisms → Archaea | 43435 | Open in IMG/M |
| 3300027893|Ga0209636_10013472 | All Organisms → cellular organisms → Archaea | 8322 | Open in IMG/M |
| 3300027893|Ga0209636_10014032 | Not Available | 8151 | Open in IMG/M |
| 3300027893|Ga0209636_10055697 | All Organisms → cellular organisms → Archaea | 3896 | Open in IMG/M |
| 3300027893|Ga0209636_10064513 | All Organisms → cellular organisms → Archaea | 3594 | Open in IMG/M |
| 3300027893|Ga0209636_10120773 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2497 | Open in IMG/M |
| 3300027893|Ga0209636_10183934 | All Organisms → cellular organisms → Archaea | 1934 | Open in IMG/M |
| 3300027893|Ga0209636_10268753 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 1520 | Open in IMG/M |
| 3300027893|Ga0209636_10381330 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1207 | Open in IMG/M |
| 3300027893|Ga0209636_10641394 | All Organisms → cellular organisms → Archaea | 845 | Open in IMG/M |
| 3300027893|Ga0209636_10727143 | All Organisms → cellular organisms → Archaea | 773 | Open in IMG/M |
| 3300027893|Ga0209636_10978747 | Not Available | 624 | Open in IMG/M |
| 3300027893|Ga0209636_11104042 | All Organisms → cellular organisms → Archaea | 570 | Open in IMG/M |
| 3300027901|Ga0209427_10008650 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 11438 | Open in IMG/M |
| 3300027901|Ga0209427_10117317 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2344 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1028975 | All Organisms → cellular organisms → Archaea | 2648 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1126971 | All Organisms → cellular organisms → Archaea | 1016 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1149845 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon BA2 | 907 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1204346 | Not Available | 729 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1290162 | Not Available | 566 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1004680 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 6068 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1050461 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1593 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1224713 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 612 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1003486 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 9001 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1009472 | All Organisms → cellular organisms → Archaea | 5255 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1013858 | All Organisms → cellular organisms → Archaea | 4238 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1030932 | All Organisms → cellular organisms → Archaea | 2624 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1179642 | Not Available | 833 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1246184 | Not Available | 665 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1277136 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon BA2 | 610 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10000011 | All Organisms → cellular organisms → Archaea | 106933 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10000072 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 46220 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10044781 | All Organisms → cellular organisms → Archaea → TACK group | 1738 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10210898 | All Organisms → cellular organisms → Archaea | 717 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10263863 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon BA2 | 625 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10075373 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 1719 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10282213 | Not Available | 707 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10298924 | All Organisms → cellular organisms → Archaea | 680 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10321022 | Not Available | 647 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1000014 | All Organisms → cellular organisms → Archaea | 311477 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1000023 | All Organisms → cellular organisms → Archaea | 243038 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1004317 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 10715 | Open in IMG/M |
| (restricted) 3300031898|Ga0315312_1056109 | Not Available | 1446 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 35.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 26.17% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 12.15% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 10.28% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 6.54% |
| Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 3.74% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.74% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.93% |
| Marine Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
| 3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300001782 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples | Environmental | Open in IMG/M |
| 3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
| 3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
| 3300003332 | Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
| 3300014886 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay15, Core 4569-2, 21-24 cm | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022205 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031593 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2 | Environmental | Open in IMG/M |
| 3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
| 3300031806 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300031898 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI2172J19969_100028523 | 3300001751 | Marine Sediment | LSLAEIMNALQDFGIFIVXILLAYVVYKAAILLEAMSNKIKGEKD* |
| JGI2172J19969_100055187 | 3300001751 | Marine Sediment | MSLTEIMNALQDFGTFIVIILLAYVVYKAAILLEAMTNKIKGEKTER* |
| JGI2172J19969_100152301 | 3300001751 | Marine Sediment | MRVLQDFGIFIIIILLAYVVYKISLLIEEISKKIKEKD* |
| JGI2172J19969_100268864 | 3300001751 | Marine Sediment | LTLTELILVLQDFGIFIIIILLAYVVYKISILIEEISK |
| JGI2173J19968_100002649 | 3300001752 | Marine Sediment | LSLAEIMNALQDFGIFIVIILLAYVVYKAAILLEAMSNKIKGEKD* |
| JGI2173J19968_102195251 | 3300001752 | Marine Sediment | LTLIELMRVLQDFGIFIIIILLAYVVYKISLLIEEISKKIKEKD* |
| WOR52_1000522717 | 3300001782 | Marine Sediment | MFAKLSLTELMRVLQDLGVFIVVILIAYVVYKIATLLEVISTKIKGEKT* |
| WOR52_100105479 | 3300001782 | Marine Sediment | MIGGFVKLTLTELMRVLQDFGIFVVVILLAYVVYKVGTMIEAITNKIKEKD* |
| WOR52_100207672 | 3300001782 | Marine Sediment | VLQDFGIFIIIILLAYVVYKISLLIEEISKKIKEKD* |
| JGI24422J19971_101714752 | 3300001854 | Marine Sediment | LTLTEIMRALQDFGTFIVIILLAYVVYKAAILVEAMSDRIKGEKD* |
| JGI24422J19971_101838392 | 3300001854 | Marine Sediment | LSLTEIMRALQDFGTFIVIILLAYVVYKAAILLEAMSNRIKGEKD* |
| JGI24422J19971_102012601 | 3300001854 | Marine Sediment | FGTFIVIILLAYVVYRIATLLEVITSKIKGEKTKI* |
| JGI24422J19971_102312601 | 3300001854 | Marine Sediment | VKLSLTEIMRAIQDFATFIVIVLLAYVVYRTATLLEAIGNKIRGE |
| JGI24422J19971_102395071 | 3300001854 | Marine Sediment | VKLTLTELMRVLEDFGTFIVIILLAYVVYRIATLLEVITSKIKGEKTRI* |
| JGI24422J19971_102546642 | 3300001854 | Marine Sediment | MKLSLAEIMNALQDFGIFIVIILLAYVVYKAAILLEAMSNKIKGEKD* |
| JGI24422J19971_103056762 | 3300001854 | Marine Sediment | VKLSLTEIMRALQDFATFIVIVLLAYVVYRTATLLEAIGNKIRGEKTEL* |
| JGI24422J19971_103625301 | 3300001854 | Marine Sediment | XFATFIVIVLLAYVVYRTATLLEAIGNKIRGEKTEL* |
| SMTZ23_100711953 | 3300002053 | Marine Sediment | MSLTENMNALQDFGTFIVIILLAYVVYKAAILLEAMTNKIKGEKN* |
| GBSed_100095531 | 3300003332 | Marine Hydrothermal Vent Sediment | ISVDRRLQDLTLTELMRVLQDFGIFIVIILLAYVVYKIGILIEAITRKIRERE* |
| Ga0115863_10185287 | 3300009034 | Sediment, Intertidal | LEAIGKLALTEITELMRVLQDFGTFIVIILLAYVVYKAAILLEAMSNKIRAEKD* |
| Ga0115863_102228913 | 3300009034 | Sediment, Intertidal | MRALQDFGIFVVIILLAYVVYRIAILVEVMSKKIQGEKNGA* |
| Ga0115863_10678443 | 3300009034 | Sediment, Intertidal | MRVLQDFGVFIVIILLAYAVYKAAILIDVIGKKIKGEKD* |
| Ga0115863_10899322 | 3300009034 | Sediment, Intertidal | MRVLQDFGAFLVIILLAYAVYKAAILIDVIGRKIKGEKD* |
| Ga0115863_11733352 | 3300009034 | Sediment, Intertidal | MSALQDFGTFIVIILLAYVVYKAAILLEAMSNKIKGEKN* |
| Ga0115863_11831512 | 3300009034 | Sediment, Intertidal | MIGGIRLTLSELMRALQDFGVFVVVILLAYAVYKVTLLIDAISNKIKGEKD* |
| Ga0115863_11900252 | 3300009034 | Sediment, Intertidal | MIGGIGKLALTEITELMRMLQDFGTFIVIILLAYVVYKAAILLEVMSNKIKGEKD* |
| Ga0115863_12063873 | 3300009034 | Sediment, Intertidal | XLQDFGTFIVIILLAYVVYKAAILLEAMSNKIKGEKN* |
| Ga0115863_12630956 | 3300009034 | Sediment, Intertidal | MRALQDFGTFIVIILLAYVVYKAVILLEAMSDKIKGEKD* |
| Ga0115863_13685021 | 3300009034 | Sediment, Intertidal | LTLTELMRVLEDFGTFIVIILLAYVVYRIATLVEVI |
| Ga0115863_14535402 | 3300009034 | Sediment, Intertidal | MRVLQDFGIFIVIILLAYVVYRIGILVEVISNKIKEEKK* |
| Ga0115863_16668032 | 3300009034 | Sediment, Intertidal | MRALQDFGTFIVIILLAYVVYKVAILLEAMSNRIKGEKD* |
| Ga0115863_17840192 | 3300009034 | Sediment, Intertidal | LTLTELMRVLQDFGIFIVIILLAYVVYRIGILVEVISNKIKEEKK* |
| Ga0114921_102315302 | 3300009150 | Deep Subsurface | ESHALMIGGIVKLSLTELMRVLQDFGTFIVIILLAYVVYKVAILLEAMSDKIKGEKD* |
| Ga0114921_103216302 | 3300009150 | Deep Subsurface | QDFGTFIVIILLAYVVYKAAILLEAMSDKIKGEKN* |
| Ga0114921_108259031 | 3300009150 | Deep Subsurface | MRVLQDFGTFIVIILLAYAVYKAAILIDVIGKKIKGEKD* |
| Ga0114921_110183172 | 3300009150 | Deep Subsurface | DFGTFIVIILLAYVVYKAAILLEAMSDKIKGEKD* |
| Ga0114925_107760421 | 3300009488 | Deep Subsurface | MRVLQDFGTFVVIILLAYAVYKAAMLIDVIGKKIKGEKD* |
| Ga0114920_100126885 | 3300009528 | Deep Subsurface | MRVLQDFGTFVVIILLAYAVYKAAILIDVIGQKIKGEKD* |
| Ga0129297_103067712 | 3300010324 | Lake Sediment | LTEIVRVLQDLGAFIVIILLAYVVYKIGNLIEVISQKIKGEKD* |
| Ga0129297_105042301 | 3300010324 | Lake Sediment | MQVLQDLGIFVVIILVAYVVYKIGILIEVISNKIKGEKD* |
| Ga0129297_105471672 | 3300010324 | Lake Sediment | PMFGGIRDLTLTELMRLLQDFGIFIVIVLLAYVVYKIGILIEVIGKKVKEEKN* |
| Ga0129298_100490742 | 3300010328 | Lake Sediment | MRVLQDFGTFVVIVLLAYAVYRTATLLEVISNKIKGEKD* |
| Ga0129298_101241083 | 3300010328 | Lake Sediment | LAELVRILQDFGIFVVVILLAYVVYKIGILIEVISDKIKGEKD* |
| Ga0129298_101277872 | 3300010328 | Lake Sediment | LTLSELVRLLQDLGVFVITILIAYVVYRIGVLVEEITSKIRREEDQLSKSEAQRR* |
| Ga0129298_101323062 | 3300010328 | Lake Sediment | MTLPELVRLLQDFGVFVVVTLLAYVVYGIGVLVEVITNKIRGEKDHPSRLEE* |
| Ga0129298_102792452 | 3300010328 | Lake Sediment | MLQDLGIFVVIILVAYVVYRIGILIEVISNKIKGEKD* |
| Ga0129298_103982661 | 3300010328 | Lake Sediment | VIGGIEDLTLTELMRLLQDFGIFIVIVLLAYVVYKIGILIEVIGKKVKEEKD* |
| Ga0129298_104552611 | 3300010328 | Lake Sediment | MRVLQDLGIFVVIILVAYVVYKIGILIEAISNKIKGEKD* |
| Ga0180300_100039516 | 3300014886 | Marine Sediment | LSLTEIIEALQDFGIFIVIILLAYVVYKAAILLEAMSDKIKAEKD* |
| Ga0224496_100416701 | 3300022204 | Sediment | LEAFVKLSLAELMRALQDFGTFIVIILLAYVVYKIATLLEVISNKIKGEKIEI |
| Ga0224496_103055331 | 3300022204 | Sediment | LTLTELMRALQDFGIFVVIILLAYVVYRIAILVEVMSKKIQGEKNGA |
| Ga0224511_102555851 | 3300022205 | Sediment | LMRALQDFGIFVVIILLAYVVYRIAILVEVMSKKIQGEKNGA |
| Ga0224506_100179194 | 3300022221 | Sediment | LEAFVKLSLAELMRALQDFGTLIVIILLAYVVYKIATLLEVISNKIKGEKIEI |
| Ga0212089_101411223 | 3300022551 | Lake Sediment | LKLTLTELMRVLQDFGTFVVIVLLAYAVYRTATLLEVISNKIKGEKD |
| Ga0209978_100355491 | 3300024263 | Deep Subsurface | LESHALMIGGIVKLSLTELMRVLQDFGTFIVIILLAYVVYKAAILLEAMSDKIKGEKD |
| Ga0209635_1000448313 | 3300027888 | Marine Sediment | LSLAEIMNALQDFGIFIVIILLAYVVYKAAILLEAMSNKIKGEKD |
| Ga0209635_100098956 | 3300027888 | Marine Sediment | MSLTEIMNALQDFGTFIVIILLAYVVYKAAILLEAMTNKIKGEKTER |
| Ga0209635_100479993 | 3300027888 | Marine Sediment | LTLTELMRVLQDFGTFIVIILLAYVVYKAAILIDVLGKKIKGEKE |
| Ga0209635_100756153 | 3300027888 | Marine Sediment | LTLTELMRVLQDFGIFIIIILLAYVVYKISLLIEEISKKIKEKD |
| Ga0209635_100876864 | 3300027888 | Marine Sediment | LTLTELMRALQDFGIFIVIILLAYVVYRIAILVEVMSKKIQGEKNEA |
| Ga0209635_102382582 | 3300027888 | Marine Sediment | LTLTELILVLQDFGIFIIIILLAYVVYKISILIEEISKKIKEKD |
| Ga0209635_106399852 | 3300027888 | Marine Sediment | MLRITGKDRRFTDLTLTELMRALQDFGIFIVIILLAYVVYKVGILFEVLSKKITGEKD |
| Ga0209635_107055922 | 3300027888 | Marine Sediment | LTLTELMRVLQDFGIFIIIILLAYVVYKISILIEEISKKIKEKD |
| Ga0209635_111406522 | 3300027888 | Marine Sediment | MRVLQDFGTFIVIILLAYVVYKAAILIDVLGKKIKGEKD |
| Ga0209636_1000035316 | 3300027893 | Marine Sediment | MFAKLSLTELMRVLQDLGVFIVVILIAYVVYKIATLLEVISTKIKGEKT |
| Ga0209636_100134723 | 3300027893 | Marine Sediment | MRVLEDFGTFIVIILLAYVVYRIATLLEVITSKIKGEKTRI |
| Ga0209636_100140321 | 3300027893 | Marine Sediment | MIGGFVKLTLTELMRVLQDFGIFVVVILLAYVVYKVGTMIEAITNKIKEKD |
| Ga0209636_100556972 | 3300027893 | Marine Sediment | VKLSLTEIMRAIQDFATFIVIVLLAYVVYRTATLLEAIGNKIRGEKTEL |
| Ga0209636_100645132 | 3300027893 | Marine Sediment | MRALQDFGTFIVIILLAYVVYKAAILVEAMSDRIKGEKD |
| Ga0209636_101207731 | 3300027893 | Marine Sediment | MIGGIGKLSLTEIMRALQDFGTFIVIILLAYVVYKAAILLEAMSNKIKGEKN |
| Ga0209636_101839342 | 3300027893 | Marine Sediment | MRALQDFGTFIVIILLAYVVYKAAILLEAMSNRIKGEKD |
| Ga0209636_102687533 | 3300027893 | Marine Sediment | MRVLQDFGIFIIIILLAYVVYKISLLIEEISKKIKEKD |
| Ga0209636_103813302 | 3300027893 | Marine Sediment | LTLTELMRVLEDFGTFIVIILLAYVVYRIATLLEVITSKIKGEKTKI |
| Ga0209636_106413941 | 3300027893 | Marine Sediment | MKLSLAEIMNALQDFGIFIVIILLAYVVYKAAILLEAMSNKIKGEKD |
| Ga0209636_107271432 | 3300027893 | Marine Sediment | LTLTEIMRALKDFGTFIVIILLAYVVYKAAILLEAMSNRIKGEKD |
| Ga0209636_109787472 | 3300027893 | Marine Sediment | MSLTEIMNALQDFGIFIVIILLAYVVYKAGILLEAMSNKIKGEKN |
| Ga0209636_111040422 | 3300027893 | Marine Sediment | ELTLTELMRVLQDFGTFIVIILLAYVVYKAAILIDVLGKKIKGEKE |
| Ga0209427_100086503 | 3300027901 | Marine Sediment | MNALQDFGIFIVIILLAYVVYKAAILLEAMSNKIKGEKD |
| Ga0209427_101173171 | 3300027901 | Marine Sediment | MRVLQDFGTFIVIILLAYVVYKAAILIDVLGKKIKGEKE |
| (restricted) Ga0315308_10289753 | 3300031587 | Sediment | EIMRVLEDFGVFVVIILLAYVVYKVGVLVEAITNKIKGGKD |
| (restricted) Ga0315308_11269711 | 3300031587 | Sediment | LTLSEIMRVLEDFGVFVVIILLAYVVYKVGVLVEVITNKIKGGKD |
| (restricted) Ga0315308_11498452 | 3300031587 | Sediment | LTLSEIMRILEDFGVFVVIILLAYVVYKVGALVEVITNKIKGGKD |
| (restricted) Ga0315308_12043462 | 3300031587 | Sediment | LTLTELMQVLQDLGIFVVIILVAYVVYKIGILIEVISNKIKGEKD |
| (restricted) Ga0315308_12901622 | 3300031587 | Sediment | LEAFEKLSLTELIRVLQDFGTFVVIVLLAYVVYKISMLLEVISNKIKGEQTEFQNDKAVK |
| (restricted) Ga0315307_10046807 | 3300031593 | Sediment | MRVLQDFGTFVVIVLLAYAVYRTATLLEVISNKIKGEKD |
| (restricted) Ga0315307_10504612 | 3300031593 | Sediment | VKLTLSEIMRVLEDFGVFVVIILLAYVVYKVGVLVEVITNKIKGGKD |
| (restricted) Ga0315307_12247131 | 3300031593 | Sediment | MRALQDLGIFIVIILLAYVVYRIGILVEVISDKIKGEKK |
| (restricted) Ga0315309_10034868 | 3300031604 | Sediment | MIGGVYELTLTETIRALQDIGTFVVIILLAYVVYKIATLLEVISNKIKGEKTKI |
| (restricted) Ga0315309_10094724 | 3300031604 | Sediment | LTEIVRVLQDLGAFIVIILLAYVVYKIGNLIEVISQKIKGEKD |
| (restricted) Ga0315309_10138582 | 3300031604 | Sediment | LTLAELVRILQDFGIFVVVILLAYVVYKIGILIEVITNKIKGEKD |
| (restricted) Ga0315309_10309323 | 3300031604 | Sediment | LAELVRILQDFGIFVVVILLAYVVYKIGILIEVISDKIKGEKD |
| (restricted) Ga0315309_11796422 | 3300031604 | Sediment | MLQDLGIFVVIILVAYVVYRIGILIEVISNKIKGEKD |
| (restricted) Ga0315309_12461841 | 3300031604 | Sediment | LTLSEIMRILEDFGVFVVIILLAYVVYKVGVLVEVITNKIKGGKD |
| (restricted) Ga0315309_12771362 | 3300031604 | Sediment | MRVLEDFGVFVVIILLAYVVYKVGVLVEAITNKIKGGKD |
| (restricted) Ga0315306_1000001157 | 3300031806 | Sediment | VKLSLTEIVRVLEDFGTFVVIVLLAYVVYRIATLLEVISNKIKGEKD |
| (restricted) Ga0315306_1000007215 | 3300031806 | Sediment | MRKLTLSEIMRVLEDFGVFVVIILLAYVVYKVGVLVEVITNKIKGGKD |
| (restricted) Ga0315306_100447812 | 3300031806 | Sediment | LTLTEIVRVLQDLGAFIVIILLAYVVYKIGNLIEVISQKIKGEKD |
| (restricted) Ga0315306_102108981 | 3300031806 | Sediment | MQVLQDLGIFVVIILVAYVVYKIGILIEVISNKIKGEKD |
| (restricted) Ga0315306_102638632 | 3300031806 | Sediment | MQKLTLSEIMRILEDFGVFVVIILLAYVVYKVGALVEVITNKI |
| (restricted) Ga0315310_100753736 | 3300031876 | Sediment | MRVLQDLGIFVVIILVAYVVYRIGILIEVISNKIKGEKD |
| (restricted) Ga0315310_102822132 | 3300031876 | Sediment | LKLSLTEIMRILEDFGTFVVIVLLAYVVYRIATLLEVISNKIKGEKD |
| (restricted) Ga0315310_102989241 | 3300031876 | Sediment | LSLTELTRVLQDFGTFVVIILLAYVVYKIATLLEVISNKIKGERI |
| (restricted) Ga0315310_103210221 | 3300031876 | Sediment | LKLTLTELMRVLQDFGTFVVIVLLAYAVYRTATLLEVISNKI |
| (restricted) Ga0315314_100001496 | 3300031877 | Sediment | MMFGGIKDLTLTELMRLLQDFGIFIVIVLLAYVVYKIGILIEVIGKKVKEERD |
| (restricted) Ga0315314_1000023275 | 3300031877 | Sediment | MRVLQDLGIFVVIILVAYVVYRIGTLIEVISNKIKGEKD |
| (restricted) Ga0315314_10043173 | 3300031877 | Sediment | MFGGIRDLTLTELMRLLQDFGIFIVIVLLAYVVYKIGILIEVIGKKVKEEKN |
| (restricted) Ga0315312_10561092 | 3300031898 | Sediment | KSRANDWRCLLKLTLTELMRVLQDFGTFVVIVLLAYAVYRTATLLEVISNKIKGEKD |
| ⦗Top⦘ |