Metagenome / Metatranscriptome Family F091247

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F091247
Family Type	Metagenome / Metatranscriptome
Number of Sequences	107
Average Sequence Length	39 residues
Representative Sequence	LVPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR
Number of Associated Samples	66
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	33.64 %
% of genes near scaffold ends (potentially truncated)	47.66 %
% of genes from short scaffolds (< 2000 bps)	84.11 %
Associated GOLD sequencing projects	61
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (62.617 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (14.953 % of family members)
Environment Ontology (ENVO)	Unclassified (31.776 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (37.383 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.38% β-sheet: 0.00% Coil/Unstructured: 65.62%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.22
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF04055	Radical_SAM	23.36
PF00044	Gp_dh_N	2.80
PF11146	DUF2905	1.87
PF00162	PGK	1.87
PF02374	ArsA_ATPase	1.87
PF02800	Gp_dh_C	1.87
PF07719	TPR_2	1.87
PF13671	AAA_33	0.93
PF02915	Rubrerythrin	0.93
PF05593	RHS_repeat	0.93
PF00701	DHDPS	0.93
PF13181	TPR_8	0.93
PF01797	Y1_Tnp	0.93
PF00696	AA_kinase	0.93
PF13722	CstA_5TM	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG0057	Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase	Carbohydrate transport and metabolism [G]	4.67
COG0126	3-phosphoglycerate kinase	Carbohydrate transport and metabolism [G]	1.87
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	1.87
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.93
COG3209	Uncharacterized conserved protein RhaS, contains 28 RHS repeats	General function prediction only [R]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.62 %
Unclassified	root	N/A	37.38 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.62 %
Unclassified	root	N/A	37.38 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.62 %
Unclassified	root	N/A	37.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	25.23 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	0.93 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.93 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.93 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	25.23 %
Nitrospinae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae	0.93 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.93 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	25.23 %
unclassified Nitrospira	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira	0.93 %
unclassified Nitrospinota	no rank	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota	0.93 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.93 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	13.08 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.93 %
Syntrophorhabdales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales	0.93 %
Nitrospira bacterium SG8_3	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3	0.93 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.93 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.93 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	11.21 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Deltaproteobacteria bacterium RBG_16_48_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10	0.93 %
Syntrophorhabdaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae	0.93 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.93 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.93 %
Nitrospira bacterium SG8_3	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3	0.93 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.93 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	11.21 %
Syntrophorhabdus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus	0.93 %
Desulfomonile	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Deltaproteobacteria bacterium RBG_16_48_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10	0.93 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.93 %
Nitrospira bacterium SG8_3	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3	0.93 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.93 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.38 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	11.21 %
Syntrophorhabdus aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	0.93 %
Desulfomonile tiedjei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei	0.93 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.93 %
Deltaproteobacteria bacterium RBG_16_48_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10	0.93 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.93 %
Nitrospira bacterium SG8_3	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3	0.93 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.93 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003858\|Ga0031656_10164740	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	771	Open in IMG/M
3300003859\|Ga0031653_10002595	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4822	Open in IMG/M
3300009053\|Ga0105095_10066266	All Organisms → cellular organisms → Bacteria	1945	Open in IMG/M
3300009053\|Ga0105095_10405308	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	753	Open in IMG/M
3300009053\|Ga0105095_10580692	Not Available	623	Open in IMG/M
3300009053\|Ga0105095_10692191	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300009078\|Ga0105106_10764905	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	689	Open in IMG/M
3300009078\|Ga0105106_10983232	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300009111\|Ga0115026_10797623	Not Available	738	Open in IMG/M
3300009153\|Ga0105094_10280254	Not Available	959	Open in IMG/M
3300009153\|Ga0105094_10514450	Not Available	696	Open in IMG/M
3300009167\|Ga0113563_13826103	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300009171\|Ga0105101_10017873	All Organisms → cellular organisms → Bacteria	3413	Open in IMG/M
3300009503\|Ga0123519_10017680	All Organisms → cellular organisms → Bacteria	9783	Open in IMG/M
3300010413\|Ga0136851_10050279	All Organisms → cellular organisms → Bacteria	4549	Open in IMG/M
3300012931\|Ga0153915_10013651	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei	7840	Open in IMG/M
3300012931\|Ga0153915_10269306	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans	1893	Open in IMG/M
3300012931\|Ga0153915_10642298	Not Available	1223	Open in IMG/M
3300012931\|Ga0153915_10869120	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	1047	Open in IMG/M
3300012931\|Ga0153915_10884856	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	1038	Open in IMG/M
3300012931\|Ga0153915_11169881	Not Available	898	Open in IMG/M
3300012931\|Ga0153915_11615420	Not Available	758	Open in IMG/M
3300012931\|Ga0153915_12054117	Not Available	669	Open in IMG/M
3300012931\|Ga0153915_13446931	Not Available	512	Open in IMG/M
3300012964\|Ga0153916_10044714	All Organisms → cellular organisms → Bacteria	3957	Open in IMG/M
3300012964\|Ga0153916_10195103	All Organisms → cellular organisms → Bacteria	2012	Open in IMG/M
3300012964\|Ga0153916_10417543	Not Available	1403	Open in IMG/M
3300012964\|Ga0153916_10578121	All Organisms → cellular organisms → Bacteria	1199	Open in IMG/M
3300012964\|Ga0153916_11874111	Not Available	671	Open in IMG/M
3300012964\|Ga0153916_12782404	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300012964\|Ga0153916_13000183	Not Available	531	Open in IMG/M
3300013078\|Ga0153914_1174660	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300014656\|Ga0180007_10457189	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	771	Open in IMG/M
3300017939\|Ga0187775_10052066	Not Available	1253	Open in IMG/M
3300017944\|Ga0187786_10471435	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300017966\|Ga0187776_10172476	Not Available	1344	Open in IMG/M
3300017966\|Ga0187776_10742150	Not Available	699	Open in IMG/M
3300017972\|Ga0187781_10482655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	889	Open in IMG/M
3300018018\|Ga0187886_1270483	Not Available	638	Open in IMG/M
3300018029\|Ga0187787_10474199	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300018032\|Ga0187788_10183878	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	803	Open in IMG/M
3300018032\|Ga0187788_10444725	Not Available	552	Open in IMG/M
3300018062\|Ga0187784_11570528	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300018064\|Ga0187773_10825631	Not Available	591	Open in IMG/M
3300018089\|Ga0187774_10431543	Not Available	811	Open in IMG/M
3300018089\|Ga0187774_10522404	Not Available	752	Open in IMG/M
3300018090\|Ga0187770_10924547	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	700	Open in IMG/M
3300020074\|Ga0194113_10827494	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10	631	Open in IMG/M
3300020222\|Ga0194125_10361956	Not Available	932	Open in IMG/M
3300022551\|Ga0212089_10044786	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2622	Open in IMG/M
3300022593\|Ga0236338_1078568	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3	700	Open in IMG/M
(restricted) 3300024341\|Ga0233421_10030372	All Organisms → cellular organisms → Bacteria	1795	Open in IMG/M
3300027713\|Ga0209286_1347264	Not Available	510	Open in IMG/M
3300027723\|Ga0209703_1200076	Not Available	735	Open in IMG/M
3300027726\|Ga0209285_10109177	Not Available	847	Open in IMG/M
3300027731\|Ga0209592_1269338	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300027740\|Ga0214474_1039457	All Organisms → cellular organisms → Bacteria	1833	Open in IMG/M
3300027811\|Ga0256868_10008460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	5053	Open in IMG/M
3300027811\|Ga0256868_10137482	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	1069	Open in IMG/M
3300027885\|Ga0209450_10138817	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	1666	Open in IMG/M
3300027885\|Ga0209450_10498511	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	891	Open in IMG/M
3300027885\|Ga0209450_10513793	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	877	Open in IMG/M
3300027900\|Ga0209253_10010032	All Organisms → cellular organisms → Bacteria	8133	Open in IMG/M
3300027900\|Ga0209253_10892571	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300027955\|Ga0209078_1147471	Not Available	655	Open in IMG/M
3300031746\|Ga0315293_10936967	Not Available	622	Open in IMG/M
(restricted) 3300031877\|Ga0315314_1314679	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300031949\|Ga0214473_10006909	All Organisms → cellular organisms → Bacteria	13518	Open in IMG/M
3300031949\|Ga0214473_10537518	Not Available	1299	Open in IMG/M
3300031949\|Ga0214473_10588050	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1230	Open in IMG/M
3300031999\|Ga0315274_10060506	All Organisms → cellular organisms → Bacteria	5055	Open in IMG/M
3300031999\|Ga0315274_10243703	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2190	Open in IMG/M
3300032053\|Ga0315284_10765330	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1123	Open in IMG/M
3300032069\|Ga0315282_10059116	All Organisms → cellular organisms → Bacteria	3981	Open in IMG/M
3300032069\|Ga0315282_10382955	Not Available	858	Open in IMG/M
3300032118\|Ga0315277_10707879	Not Available	968	Open in IMG/M
3300032156\|Ga0315295_10251191	All Organisms → cellular organisms → Bacteria	1785	Open in IMG/M
3300032163\|Ga0315281_10744155	Not Available	1017	Open in IMG/M
3300032163\|Ga0315281_10895547	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	908	Open in IMG/M
3300032163\|Ga0315281_11227434	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300032401\|Ga0315275_11683095	Not Available	676	Open in IMG/M
3300032829\|Ga0335070_10066565	All Organisms → cellular organisms → Bacteria	3886	Open in IMG/M
3300032892\|Ga0335081_10103395	All Organisms → cellular organisms → Bacteria	4226	Open in IMG/M
3300033004\|Ga0335084_10267616	All Organisms → cellular organisms → Bacteria	1769	Open in IMG/M
3300033413\|Ga0316603_10304537	Not Available	1409	Open in IMG/M
3300033413\|Ga0316603_10851812	Not Available	858	Open in IMG/M
3300033413\|Ga0316603_12140930	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300033419\|Ga0316601_100994855	Not Available	837	Open in IMG/M
3300033433\|Ga0326726_10201352	All Organisms → cellular organisms → Bacteria	1838	Open in IMG/M
3300033433\|Ga0326726_10301029	All Organisms → cellular organisms → Bacteria	1504	Open in IMG/M
3300033480\|Ga0316620_10192442	All Organisms → cellular organisms → Bacteria	1691	Open in IMG/M
3300033480\|Ga0316620_10454286	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1173	Open in IMG/M
3300033480\|Ga0316620_10639787	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300033480\|Ga0316620_10664875	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	986	Open in IMG/M
3300033480\|Ga0316620_11406391	Not Available	688	Open in IMG/M
3300033481\|Ga0316600_10466280	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	873	Open in IMG/M
3300033486\|Ga0316624_10357399	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	1206	Open in IMG/M
3300033486\|Ga0316624_11070270	Not Available	729	Open in IMG/M
3300033487\|Ga0316630_10330149	Not Available	1188	Open in IMG/M
3300033489\|Ga0299912_10063177	All Organisms → cellular organisms → Bacteria	3241	Open in IMG/M
3300033489\|Ga0299912_10409655	Not Available	1110	Open in IMG/M
3300033804\|Ga0314863_029360	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1113	Open in IMG/M
3300033977\|Ga0314861_0089496	All Organisms → cellular organisms → Bacteria	1595	Open in IMG/M
3300034083\|Ga0373901_103033	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12	599	Open in IMG/M
3300034090\|Ga0326723_0586787	Not Available	515	Open in IMG/M
3300034165\|Ga0364942_0264929	Not Available	562	Open in IMG/M
3300034894\|Ga0373916_0005168	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1400	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.13%
Engineered	Engineered	1.87%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	57.94%
Terrestrial	Environmental → Terrestrial	40.19%
Bioremediation	Engineered → Bioremediation	1.87%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	56.07%
Soil	Environmental → Terrestrial → Soil	36.45%
Peat	Environmental → Terrestrial → Peat	2.80%
Metal	Engineered → Bioremediation → Metal	1.87%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.93%
Sediment	Environmental → Aquatic → Sediment	0.93%
Floodplain	Environmental → Terrestrial → Floodplain	0.93%

Habitat	Taxonomy	Distribution
Wetlands	Environmental → Terrestrial → Soil → Wetlands	28.97%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	17.76%
Lake	Environmental → Aquatic → Freshwater → Lake	16.82%
Sediment	Environmental → Aquatic → Freshwater → Sediment	14.02%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	7.48%
Lentic	Environmental → Aquatic → Freshwater → Lentic	6.54%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.80%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	1.87%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.93%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.93%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	28.97%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	16.82%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	14.02%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	13.08%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	6.54%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	5.61%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	3.74%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.80%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.87%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	1.87%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	14.95%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	14.95%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	13.08%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	12.15%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	12.15%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	6.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	5.61%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	2.80%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.87%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.87%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	1.87%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	1.87%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.93%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	0.93%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.93%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.93%
Hot Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring	0.93%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	0.93%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003858	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI	Environmental	Open in IMG/M
3300003859	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009503	Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02	Environmental	Open in IMG/M
3300010413	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300013078	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300014656	Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018018	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300022551	Boni_combined assembly	Environmental	Open in IMG/M
3300022593	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2	Environmental	Open in IMG/M
3300024341 (restricted)	Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_107_MG	Environmental	Open in IMG/M
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027723	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027726	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027740	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq	Environmental	Open in IMG/M
3300027811	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027955	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031877 (restricted)	Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032069	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental	Open in IMG/M
3300033804	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20	Environmental	Open in IMG/M
3300033977	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75	Environmental	Open in IMG/M
3300034083	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.2	Engineered	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034165	Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17	Environmental	Open in IMG/M
3300034894	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0031656_101647401	3300003858	Freshwater Lake Sediment	VEQLVEEQPPQEELAVLLNFPPLEKAKADIIRLTLLLLHSGQMIF*
Ga0031653_100025952	3300003859	Freshwater Lake Sediment	LELQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH*
Ga0105095_100662663	3300009053	Freshwater Sediment	VDEQVPQDELAVFLNFPPTEKAKEDIMRLTFLLLH*
Ga0105095_104053082	3300009053	Freshwater Sediment	YLEPQVEQLVAAQPPQEELAVLLNFPPTEKAKADIIR*
Ga0105095_105806921	3300009053	Freshwater Sediment	LEPQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPLHL
Ga0105095_106921912	3300009053	Freshwater Sediment	VLQVEQLVAEQPPQEELAVLLNFPPLEKAKADITR*
Ga0105106_107649051	3300009078	Freshwater Sediment	IRQYYLPQVEQVVAAQPPQEELAALLNFPPLEKAKADIIR*
Ga0105106_109832322	3300009078	Freshwater Sediment	VLQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIRWTFLL*
Ga0115026_107976232	3300009111	Wetland	LLQPEQLLDEQEQHEELAVLLNFPPTQKAKADMTRVTFLLLHSG
Ga0105094_102802542	3300009153	Freshwater Sediment	VDEQVPQDELAVLLNFPPTEKAKEDIMRLTFLLLH*
Ga0105094_105144502	3300009153	Freshwater Sediment	LEPQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPL
Ga0113563_138261032	3300009167	Freshwater Wetlands	SYLLHDEQLLAEQPPQDELAVLLNFPPLEKAKADIIRSTFLLLH*
Ga0105101_100178731	3300009171	Freshwater Sediment	LLQPEQLLEEQEPHEELAVLLNFPPTEKAKADMTRVT
Ga0123519_1001768015	3300009503	Hot Spring	LAPFPFYFELQEEQEVAEQLLQEELAVLLNFPPLEK
Ga0136851_100502796	3300010413	Mangrove Sediment	VPQVEQLVAAQPPQEEVPVLLNFPPLEKAKADIIRWTFLLLH*
Ga0153915_100136512	3300012931	Freshwater Wetlands	LELQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIR*
Ga0153915_102693063	3300012931	Freshwater Wetlands	YYLEQVEQLVAAQPPQEELAVLLNFPPTEKAKADIIR*
Ga0153915_106422982	3300012931	Freshwater Wetlands	LEPQVVQLVAEQPPQEELAVLLNFPPLEKAKADIIR*
Ga0153915_108691201	3300012931	Freshwater Wetlands	VEQLVDEQVPQEELAVLLNFPPTEKANEDIIRLTFLLLH*
Ga0153915_108848562	3300012931	Freshwater Wetlands	RTLRYFPQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIR*
Ga0153915_111698811	3300012931	Freshwater Wetlands	LEPQVEQLLEEQVPQEELAVLLNLPPLEKANADIIR*
Ga0153915_116154201	3300012931	Freshwater Wetlands	LELQVEQLVEAQPLQEEFAVLLNFLPMENAKADIIRVTFLLLH*
Ga0153915_120541171	3300012931	Freshwater Wetlands	LEPQVEQVVAAQPLQEELAVLLNFPPLEKAKADIIL*
Ga0153915_134469312	3300012931	Freshwater Wetlands	LDPQVEQLGAEQVPQEELAVLLNFPPLEKANADIMRL
Ga0153916_100447142	3300012964	Freshwater Wetlands	VPQVEQLAAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH*
Ga0153916_101951033	3300012964	Freshwater Wetlands	LDPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIVR*
Ga0153916_104175431	3300012964	Freshwater Wetlands	VEQLVAAQPPQDELAVLLNFPPLENAKADIIRPTFLLLH
Ga0153916_105781212	3300012964	Freshwater Wetlands	LEPQVEQVVAEHVPQEEPAVLLNFPPTDKAKADITR*
Ga0153916_118741112	3300012964	Freshwater Wetlands	LEQVEQLLDEQVPQEELAVLLNLPPLEKAKADIIR*
Ga0153916_127824042	3300012964	Freshwater Wetlands	VPQVEQLLEEQVPQEEPAVLLNFPPTEKAKADIIR*
Ga0153916_130001831	3300012964	Freshwater Wetlands	LEPQVEQLDEEQLPQEELVVLLNFPLTEKAKADMMRRTFLLLHF
Ga0153914_11746601	3300013078	Freshwater Wetlands	LNPTTLYLEPQVEQVVAAQPLQEELVVLLNFPPLEKAKADIIL*
Ga0180007_104571891	3300014656	Groundwater	PPQEELAVLLNFPPLEKAKADIIRLTLLLLHSGQMIF*
Ga0187775_100520661	3300017939	Tropical Peatland	VEQLVEEQPLQEELAVLLNFPLLEKAKADIIRWTF
Ga0187786_104714351	3300017944	Tropical Peatland	VPQVEQLVAAQPVQEELAVLLNFPPTEKAKADIIL
Ga0187776_101724762	3300017966	Tropical Peatland	LEPQVEQLVAAHPLQEELAVLLNFPPLEKAKADIVR
Ga0187776_107421501	3300017966	Tropical Peatland	LDPQDEQLVAEHPPQDELAVLLNFPPLEKAKADIIRSTFLLLH
Ga0187781_104826551	3300017972	Tropical Peatland	LEPQVEQEVAEQVPQEELAVLLNFPPTEKAKADITR
Ga0187886_12704832	3300018018	Peatland	LELQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR
Ga0187787_104741991	3300018029	Tropical Peatland	LEPQVEQLVAAQPLQEELVVLLNFPPLEKAKADIMR
Ga0187788_101838782	3300018032	Tropical Peatland	VDTYLEQVEQLVAAQPPQEELAVLLNFPPTEKAKADMIR
Ga0187788_104447252	3300018032	Tropical Peatland	VEQLVAAQLPQEEPAVLLNFPPTEKAKADITRWTFLLLHFGQAIFS
Ga0187784_115705281	3300018062	Tropical Peatland	LIYFEPQVEQVVAEQVPQEEPAVLLNFPPTERAKADITR
Ga0187773_108256312	3300018064	Tropical Peatland	LEPQVEQLVAAQPLHEELAVLLNFPLLEKAKADIIRWTFLLL
Ga0187774_104315432	3300018089	Tropical Peatland	MRLHYLPQVEQLVAAQPVQEELAVLLNFPPTEKAKADIIRWTFLLLH
Ga0187774_105224041	3300018089	Tropical Peatland	LEPQVEQLLGEEQLPQEELAVLLNFPPTEKAKADMTRRTFLLLH
Ga0187770_109245471	3300018090	Tropical Peatland	LEPQVEQEVAEHVPQEELAVLLNFPPTEKAKADITR
Ga0194113_108274942	3300020074	Freshwater Lake	VEQLLEEQPPQEELAVLLNFPPLEKAKADIIRPTFL
Ga0194125_103619562	3300020222	Freshwater Lake	LWQVEQLLEEQPLQEELAVLLNFPPLEKAKADIIRLT
Ga0212089_100447861	3300022551	Lake Sediment	LEQVEQLVAEQVPQEELAVLLNLPPLEKAKADIIR
Ga0236338_10785681	3300022593	Freshwater	LPQPEQFPEEQLPQDELAVLLNFPPLEKAKADIFRLTFLALHLGQPIFSE
(restricted) Ga0233421_100303721	3300024341	Freshwater	VEQLEEEQPLQEELAVLLNFPPLEKAKADIIRLTFLLLHS
Ga0209286_13472641	3300027713	Freshwater Sediment	VEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLP
Ga0209703_12000762	3300027723	Freshwater Sediment	VEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPLHLG
Ga0209285_101091772	3300027726	Freshwater Sediment	VKIYLLQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLPL
Ga0209592_12693381	3300027731	Freshwater Sediment	RYLEPQVEQLVAAQPPQEELAVLLNFPPTEKAKADIIR
Ga0214474_10394572	3300027740	Soil	LNPRTLYLEPQVEQVVAAQPLQEELAVLLNFPPLEKAKADIIL
Ga0256868_100084604	3300027811	Soil	VKFVKSHLPQVEQLLDEQVPQEELAVLLNFPPLEKAKADIIRLTFLLLH
Ga0256868_101374821	3300027811	Soil	ILRTDYLEPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR
Ga0209450_101388172	3300027885	Freshwater Lake Sediment	LELQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH
Ga0209450_104985112	3300027885	Freshwater Lake Sediment	QVEQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTFLLLH
Ga0209450_105137931	3300027885	Freshwater Lake Sediment	EQLVAEQPPQEELAVLLNFPPLEKAKADIIRWTLLLLH
Ga0209253_100100321	3300027900	Freshwater Lake Sediment	EPQVEQLVEEQPPQEELAVLLNFPPLEKAKADIIRLTLLLLHSGQIIF
Ga0209253_108925711	3300027900	Freshwater Lake Sediment	LEQVEQLLDEQVPQEELAALLNLLPLEKAKADIIR
Ga0209078_11474711	3300027955	Freshwater Sediment	VKIYLLQVEQLVAAHPPQDEDAVLLNFPPLEKAKADIIRLTFLP
Ga0315293_109369672	3300031746	Sediment	VEQLVEEQPLQEELAVLLNFPPLEKAKEDIIRLTF
(restricted) Ga0315314_13146791	3300031877	Sediment	YLEQVEQLVAEQVPQEELAVLLNLPPLEKAKADIIR
Ga0214473_1000690915	3300031949	Soil	VPQVEQLVAEQPPQEELAVLLNFSPLEKAKADIIR
Ga0214473_105375181	3300031949	Soil	VPQVEQLVDEQVPQDELAVLLNFPPLEKAKADIIRLTFLLLHLGQAIF
Ga0214473_105880502	3300031949	Soil	LPQVEQLVDEQVPQEEPAVLLNFPPLEKANEDIIRLTFLFLH
Ga0315274_100605062	3300031999	Sediment	LPQVEQLLDEQVPQEELAVLLNFPPLEKAKADIIRLTFLLLH
Ga0315274_102437031	3300031999	Sediment	LLQPEQLLDEQEPHEELAVLLNFPPTEKAKADMTRVTFL
Ga0315284_107653302	3300032053	Sediment	LLQPEQLLDEQEPHEELAVLLNFPPTEKAKADMTRVT
Ga0315282_100591164	3300032069	Sediment	VPQVEQLADEQVPQEELAVLLNFPPLEKAKEDIIRFTFLLLH
Ga0315282_103829552	3300032069	Sediment	VLQVEQLVAEQVPQDELAVLLNFPPLEKAKADIIRLTFLLLH
Ga0315277_107078792	3300032118	Sediment	LEQVEQLLDEQVPQEELAVLLNLPPLEKAKADIIR
Ga0315295_102511912	3300032156	Sediment	VEQLVEEQPPQEELAVLLNFPPLEKAKADIIRLTLLFLHSGQIIF
Ga0315281_107441552	3300032163	Sediment	VEQLVEEQPLQEELAVLLNFPPLEKAKEDIIRLTFLF
Ga0315281_108955472	3300032163	Sediment	LEPQVEQLVDEQVPQEEPAVLLNFPPLEKANEDIIRLTFLLLH
Ga0315281_112274342	3300032163	Sediment	LEPQVEQVVAAQPLQEELAVLLNLPPLEKAKADIIR
Ga0315275_116830952	3300032401	Sediment	VDEQVPQDELAVLLNFPLLEKAKADIIRLTFLLLHLGQAI
Ga0335070_100665651	3300032829	Soil	LEPQVEQLVAAQPLHEELAVLLNLPPLEKAKADIIR
Ga0335081_101033953	3300032892	Soil	LEPQVEQVVAEQVPQEEPAVLLNFPPTEKAKADITR
Ga0335084_102676162	3300033004	Soil	VPQVEQLVAAHPLQEELAVLLNFPPLEKAKADIVR
Ga0316603_103045372	3300033413	Soil	LWRCRVHLLQPEQLLEEQPPQEELAVLVNFPPLEKAKEDIFRLTFFVLHLG
Ga0316603_108518121	3300033413	Soil	VEQLVAPQLPQEEDAVLLNFPPLEKAKADIIRPTFLLLHL
Ga0316603_121409302	3300033413	Soil	LEDEQLPQEELAVLLNFPPTENAKADITRRTFLLLHLGQAIF
Ga0316601_1009948551	3300033419	Soil	LEPQLEQLLDEQVPQEELAVLLNFPPLEKAKADIIRLTFLLLHCGQ
Ga0326726_102013522	3300033433	Peat Soil	LEPQVEQLADEQVPQEELAVLLSFPPTEKANADIIRLTFLLLH
Ga0326726_103010292	3300033433	Peat Soil	LEPQVEQVVAEQAPQEELAVLLNFPPTEKAKADITR
Ga0316620_101924423	3300033480	Soil	LELQVEQLVAAQPPQEELAVLLNFPPLEKAKADIIR
Ga0316620_104542861	3300033480	Soil	LPQVEQLVDEQVPQEELAVLLNFPPTEKANEDIIRLTFLLLH
Ga0316620_106397872	3300033480	Soil	LEPQVVQLVAEQPPQEELAVLLNFPPLEKAKADIIR
Ga0316620_106648752	3300033480	Soil	LGFNGYLEPQVEQLVAEQPPQEELAVLLNFPPLEKAKADITR
Ga0316620_114063912	3300033480	Soil	MGGVLYLEPQVEQLGEAQLPQEEPAVLLNFPPTEKANADIIR
Ga0316600_104662801	3300033481	Soil	VEQLLGDEQLPQEELAVLLNFPPTEKAKADMTRRTFLLLHLGQAIFSEL
Ga0316624_103573992	3300033486	Soil	LEPQVEQVVAEQVPQEELAVLLNFPPTEKAKADITR
Ga0316624_110702702	3300033486	Soil	LEPQVEQVVAEHVPQEEPAVLLNFPPTDKAKADITR
Ga0316630_103301492	3300033487	Soil	LLQVEQLVAAQPPQEELAVLLNFPPTEKAKADIMR
Ga0299912_100631772	3300033489	Soil	LLQVEQVVAAQPLQEELAVLLNFPPLEKAKADIIL
Ga0299912_104096551	3300033489	Soil	VDEQVPQDELAVLLNFPPLEKAKADIIRLTFLLLHL
Ga0314863_029360_1_108	3300033804	Peatland	EPQVEQLVAAQPLQEELAVLLNFPPTEKAKADIIR
Ga0314861_0089496_3_116	3300033977	Peatland	YFEPQVEQVVAEQVPQEEPAVLLNFPPTEKAKADITR
Ga0373901_103033_2_115	3300034083	Sediment Slurry	YLEPQVEQVVAAQPLQEELAVLLNFPLLEKAKADIIL
Ga0326723_0586787_25_132	3300034090	Peat Soil	LEQVEQLVAAQPPQDELAVLLNFPPTEKAKADMIR
Ga0364942_0264929_54_164	3300034165	Sediment	LVPQVEQLVAEQPPQEELAVLLNFPPLEKAKADIIR
Ga0373916_0005168_1276_1386	3300034894	Sediment Slurry	LEPQVEQLVAEQPPQEELAVLLNFPPLEKAKGDIVR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters