Metagenome / Metatranscriptome Family F091234

Overview

Basic Information

• Family ID: F091234
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 107
• Average Sequence Length: 46 residues
• Representative Sequence: VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVK
• Number of Associated Samples: 75
• Number of Associated Scaffolds: 107

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.87 %
• % of genes near scaffold ends (potentially truncated): 99.07 %
• % of genes from short scaffolds (< 2000 bps): 99.07 %
• Associated GOLD sequencing projects: 75
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (95.327 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (75.701 % of family members)
• Environment Ontology (ENVO): Unclassified (88.785 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (77.570 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 30.56%
  β-sheet: 0.00%
  Coil/Unstructured: 69.44%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
All Organisms	root	All Organisms	4.67 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
cellular organisms	root	All Organisms → cellular organisms	4.67 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	4.67 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	4.67 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4.67 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	4.67 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4.67 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	4.67 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	4.67 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	4.67 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4.67 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	4.67 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	4.67 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	4.67 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	4.67 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	4.67 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4.67 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	4.67 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.67 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	3.74 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	3.74 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.74 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.74 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	2.80 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.33 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.80 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005331|Ga0070670_101645092	Not Available	590
3300005335|Ga0070666_10825123	Not Available	684
3300005618|Ga0068864_102021102	Not Available	582
3300005842|Ga0068858_101072338	Not Available	790
3300009092|Ga0105250_10276965	Not Available	721
3300009553|Ga0105249_11194237	Not Available	832
3300009553|Ga0105249_12402731	Not Available	600
3300009973|Ga0105136_112281	Not Available	532
3300009976|Ga0105128_109923	Not Available	645
3300009980|Ga0105135_113657	Not Available	656
3300009990|Ga0105132_128478	Not Available	589
3300009994|Ga0105126_1022444	Not Available	696
3300010371|Ga0134125_11862030	Not Available	654
3300010397|Ga0134124_11323386	Not Available	744
3300010403|Ga0134123_12109326	Not Available	624
3300010403|Ga0134123_12405362	Not Available	592
3300014968|Ga0157379_12259349	Not Available	541
3300015270|Ga0182183_1008445	Not Available	1010
3300015273|Ga0182102_1014757	Not Available	683
3300015280|Ga0182100_1075798	Not Available	555
3300015280|Ga0182100_1079062	Not Available	547
3300015284|Ga0182101_1055151	Not Available	618
3300015290|Ga0182105_1058687	Not Available	625
3300015290|Ga0182105_1059553	Not Available	622
3300015297|Ga0182104_1045381	Not Available	707
3300015297|Ga0182104_1088413	Not Available	564
3300015301|Ga0182184_1044784	Not Available	664
3300015301|Ga0182184_1072301	Not Available	566
3300015301|Ga0182184_1087667	Not Available	529
3300015306|Ga0182180_1080488	Not Available	534
3300015311|Ga0182182_1079260	Not Available	590
3300015311|Ga0182182_1086537	Not Available	571
3300015311|Ga0182182_1095601	Not Available	551
3300015312|Ga0182168_1073371	Not Available	640
3300015312|Ga0182168_1076566	Not Available	631
3300015312|Ga0182168_1094657	Not Available	582
3300015315|Ga0182120_1087908	Not Available	602
3300015315|Ga0182120_1115247	Not Available	542
3300015315|Ga0182120_1118927	Not Available	536
3300015316|Ga0182121_1074892	Not Available	659
3300015319|Ga0182130_1043132	Not Available	758
3300015320|Ga0182165_1112082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	562
3300015320|Ga0182165_1133602	Not Available	524
3300015326|Ga0182166_1093876	Not Available	595
3300015326|Ga0182166_1108041	Not Available	565
3300015329|Ga0182135_1066455	Not Available	697
3300015329|Ga0182135_1083171	Not Available	642
3300015330|Ga0182152_1081689	Not Available	648
3300015333|Ga0182147_1163955	Not Available	509
3300015335|Ga0182116_1108031	Not Available	627
3300015335|Ga0182116_1112494	Not Available	617
3300015335|Ga0182116_1121656	Not Available	597
3300015337|Ga0182151_1116286	Not Available	582
3300015337|Ga0182151_1125672	Not Available	565
3300015337|Ga0182151_1151016	Not Available	523
3300015338|Ga0182137_1108925	Not Available	624
3300015338|Ga0182137_1144452	Not Available	552
3300015339|Ga0182149_1129410	Not Available	570
3300015340|Ga0182133_1119590	Not Available	618
3300015340|Ga0182133_1161741	Not Available	543
3300015348|Ga0182115_1101845	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	903
3300015348|Ga0182115_1254525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	558
3300015349|Ga0182185_1134170	Not Available	730
3300015349|Ga0182185_1259021	Not Available	530
3300015349|Ga0182185_1259356	Not Available	530
3300015350|Ga0182163_1215026	Not Available	602
3300015352|Ga0182169_1276706	Not Available	543
3300015353|Ga0182179_1055751	Not Available	1092
3300015354|Ga0182167_1340020	Not Available	526
3300017408|Ga0182197_1096832	Not Available	597
3300017408|Ga0182197_1121695	Not Available	547
3300017408|Ga0182197_1128550	Not Available	536
3300017412|Ga0182199_1108364	Not Available	646
3300017421|Ga0182213_1210692	Not Available	554
3300017422|Ga0182201_1041774	Not Available	765
3300017432|Ga0182196_1078855	Not Available	638
3300017432|Ga0182196_1081072	Not Available	632
3300017432|Ga0182196_1121335	Not Available	550
3300017435|Ga0182194_1100644	Not Available	591
3300017439|Ga0182200_1065456	Not Available	693
3300017439|Ga0182200_1162647	Not Available	504
3300017440|Ga0182214_1116788	Not Available	577
3300017445|Ga0182198_1154366	Not Available	561
3300017691|Ga0182212_1115729	Not Available	605
3300020023|Ga0182178_1006795	Not Available	759
3300020023|Ga0182178_1018329	Not Available	544
3300028050|Ga0268328_1029465	Not Available	692
3300028056|Ga0268330_1005512	Not Available	1107
3300028058|Ga0268332_1077125	Not Available	508
3300028141|Ga0268326_1008982	Not Available	578
3300028151|Ga0268308_1031030	Not Available	518
3300028152|Ga0268336_1018088	Not Available	596
3300028253|Ga0268316_1021829	Not Available	525
3300028256|Ga0268304_1014985	Not Available	512
3300028472|Ga0268315_1018625	Not Available	570
3300032466|Ga0214503_1188832	Not Available	642
3300032469|Ga0214491_1036779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1155
3300032697|Ga0214499_1227887	Not Available	575
3300032699|Ga0214494_1079496	Not Available	622
3300032812|Ga0314745_1002346	Not Available	2745
3300032812|Ga0314745_1060385	Not Available	814
3300032824|Ga0314735_1106248	Not Available	516
3300032913|Ga0314739_1042372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	858
3300032914|Ga0314750_1040238	Not Available	1057
3300032934|Ga0314741_1126252	Not Available	580
3300032959|Ga0314738_1072109	Not Available	617
3300033535|Ga0314759_1275086	Not Available	533

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.26%
Environmental	Environmental	3.74%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.26%
Terrestrial	Environmental → Terrestrial	3.74%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	84.11%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.61%
Unclassified	Host-Associated → Plants → Unclassified	4.67%
Soil	Environmental → Terrestrial → Soil	3.74%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.87%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.11%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	4.67%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.74%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.87%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.87%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.11%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	4.67%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.87%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.87%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	75.70%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	8.41%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	4.67%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032914	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032959	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070670_1016450922	3300005331	Switchgrass Rhizosphere	VNKSRRDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVKRKL
Ga0070666_108251232	3300005335	Switchgrass Rhizosphere	MVNKSRRDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVKRKLTSKSSRSNVRRP*ST*KNS
Ga0068864_1020211021	3300005618	Switchgrass Rhizosphere	VNKSRRDDNNAPGSQSLNQLDNF*IDLNEATAMRPVAKAQIYSVKQKL
Ga0068858_1010723383	3300005842	Switchgrass Rhizosphere	VNKSRRDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVKRKLTSK
Ga0105250_102769651	3300009092	Switchgrass Rhizosphere	MNKSRQDDSDVPGSQSLDKLGNF*KDLNEATTMRPVAKAQIYSVKQKLTSK
Ga0105249_111942371	3300009553	Switchgrass Rhizosphere	VNKSRRDNSNAPGSQSLDKIDNF*IDLNEATAMRPVAKAQIYSVKQKLTS
Ga0105249_124027311	3300009553	Switchgrass Rhizosphere	VNKSRQDDSDAPGSQSLDKLDNF*IDLNEATTIRPVAKAQIYSV
Ga0105136_1122812	3300009973	Switchgrass Associated	VNKSRRDDGDATGSQSLDKLDNF*IDLNEATAMRPVAKAQIY
Ga0105128_1099231	3300009976	Switchgrass Associated	VNKS**DDSDALGSQSLDKLDNF*IDRNEATVMRSEGKAQIY
Ga0105135_1136571	3300009980	Switchgrass Associated	VNKSRRDDSDAPRSQSLDKLNNF*IDLNEATAMRPVAKAQIYSVKQKLTS
Ga0105132_1284781	3300009990	Switchgrass Associated	VNKSRRDDNDTPGSQSLDKLDNF*IDLNEAIAMRPVAKAQIYSVKQKLTSKSSRSNVRRP
Ga0105126_10224441	3300009994	Switchgrass Associated	VNKSRRDNSDAPGSQSLDELDNF*IDLNEATAMRPVAKAQIYLIKQKLTIKPSRSNV
Ga0134125_118620302	3300010371	Terrestrial Soil	VNKSRQCDSDTPGSQSLYQLDNFCIDLNEATAMRPVANAQIYSVKRK
Ga0134124_113233861	3300010397	Terrestrial Soil	VNKS*RDDSDTPGSQSLDKLDIF*IDLNEATAIRPEAKAQIYSVNKNLSADQVARM*CVL
Ga0134123_121093261	3300010403	Terrestrial Soil	VNKSRRDDSDAPESRSLDKLGNF*IDLNEATAMRLVAKAQI
Ga0134123_124053621	3300010403	Terrestrial Soil	VNKSRRDDSDAPGSQSLDELDNFRIDLNEATAMRPVAKAQIYSVKQKLTSKPSRSNVRRP
Ga0157379_122593491	3300014968	Switchgrass Rhizosphere	VNKSRRDDSDASRSQNLDELDNF*IDLNEATAMRPVAKAQIYSVKQKLTSKPSRSNVR
Ga0182183_10084451	3300015270	Switchgrass Phyllosphere	VNKSRRDDSDASRSQNLDELDNF*IDLNEATAMRPVAKAQIYSVKRKLT
Ga0182102_10147571	3300015273	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNF*IDLNEATTMRPVAKAQIYLVKLKLT
Ga0182100_10757982	3300015280	Switchgrass Phyllosphere	VNKSRRDDNDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQ
Ga0182100_10790621	3300015280	Switchgrass Phyllosphere	MNKFRRDDSDAPRSQSLDKLDTF*IDLNEATTMRPVAKAQI
Ga0182101_10551511	3300015284	Switchgrass Phyllosphere	VNKSRRDNSDTPGSQSLDKLDNFLIDLNEATAMCPVAKAQIYSVKQK
Ga0182105_10586871	3300015290	Switchgrass Phyllosphere	VNKSKRDDIDTPGSQSLDKFDNF*IDLNEATKMRPVAK
Ga0182105_10595532	3300015290	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSLDKLDNF*IDLNEATAMRQVAKAQIYSVKQK
Ga0182104_10453811	3300015297	Switchgrass Phyllosphere	VNKSRRDDNDAPGSQSLDKLNKF*IDLNEATAMRPVAKAQIY
Ga0182104_10884132	3300015297	Switchgrass Phyllosphere	VNKSRQDDSDTPRSQSLDKLDNF*IDLNESTEMRLEAKAQIYSVNDHLPADQI
Ga0182184_10447841	3300015301	Switchgrass Phyllosphere	VNKSRRDNSDTPGSQSLDKLDNF*IDLNEATAMRPVAKA
Ga0182184_10723011	3300015301	Switchgrass Phyllosphere	MNKSRRDDSDAPGSQSLDELDNF*IDLNEATAIRLVAKAQIYSVKQKL
Ga0182184_10876672	3300015301	Switchgrass Phyllosphere	VNKSR*DDSDAPKSQSLDKLDNF*IDLNEATAMRPVAKAQI
Ga0182180_10804881	3300015306	Switchgrass Phyllosphere	VNKSRRDNSDAPKSQSLDELDNF*INLNEATAMRPVA
Ga0182182_10792601	3300015311	Switchgrass Phyllosphere	VNKSRRDNSDAPGSQSLNKLDNF*IDLNEATAMRPVAKAQIY
Ga0182182_10865371	3300015311	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSLDKLNNF*IDLNEATAMRPEAKAQIYSVNKNL
Ga0182182_10956011	3300015311	Switchgrass Phyllosphere	VNKYRRDDSDAPGSQSLDELDNF*IDLNEATAMRPVAKAQIYS
Ga0182168_10733711	3300015312	Switchgrass Phyllosphere	VNKSRRDDGDAPGSQSLDQLDNF*IDLNEATAMRPVAKAQIY
Ga0182168_10765661	3300015312	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVKQKLTS
Ga0182168_10946571	3300015312	Switchgrass Phyllosphere	VNKSRRDNSDAPGSQSLDKLDNF*IDLNEVTAMRPVAKAQIYSV
Ga0182120_10879081	3300015315	Switchgrass Phyllosphere	VNKSRQDDSDAPESQSLDKLDNF*IYLNEATAMRPVAKAQIYSVKQKLTSKSSRLN
Ga0182120_11152471	3300015315	Switchgrass Phyllosphere	VNKSRRDDSDAPRSQSLDKLDNF*IDLNEATTMRPVAKA
Ga0182120_11189272	3300015315	Switchgrass Phyllosphere	MNKSR*DDSDVPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVK*KLTSKSSR
Ga0182121_10748921	3300015316	Switchgrass Phyllosphere	VNKSRQDDSDAPGNQRLDKLDNF*IDLNEATAMRPVGKAQIY
Ga0182130_10431321	3300015319	Switchgrass Phyllosphere	VNKSRQDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVKQKLTSKPNRSNVRCP
Ga0182165_11120821	3300015320	Switchgrass Phyllosphere	VNKSRRDDSDVPGSQSLDELDNF*IDLNEATTMRPI
Ga0182165_11336021	3300015320	Switchgrass Phyllosphere	MNKSR*DDSDAPGSQSLDELDNF*IDLNEATVMRPVA
Ga0182166_10938761	3300015326	Switchgrass Phyllosphere	VNKSR*DDSDAPGSQNLDELDNF*IDLNEATAMRPIAKAQIYSVKRKLTSKLSRSNVRRP
Ga0182166_11080411	3300015326	Switchgrass Phyllosphere	LVNKSK*DDSDAPGSQSLDKLDNF*IDLNEATMMRLVAKA*
Ga0182135_10664551	3300015329	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDELDNF*IDLNEATAMRPVGKAQIYSVKR
Ga0182135_10831711	3300015329	Switchgrass Phyllosphere	VNKSRRDNSDAPESQSLDKLDNF*IDLNEATAMRPVAKAQ
Ga0182152_10816891	3300015330	Switchgrass Phyllosphere	VNKSRRDDSDVPGSQSLDKLDNF*IDLKEATAMRPVANAQMYSVKRK
Ga0182147_11639551	3300015333	Switchgrass Phyllosphere	VNKSRRDDNDTPGSQSLDKLDNF*IDLNEATAMRPEAKAQIYS
Ga0182116_11080311	3300015335	Switchgrass Phyllosphere	VNKSRRDNSDALESQSLDKLDNF*IDLNEATVMRPVAKAQIYSV
Ga0182116_11124941	3300015335	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIYSVKRK
Ga0182116_11216561	3300015335	Switchgrass Phyllosphere	MNKYRRDESDTPGSQSLDELDKF*IDLNEATAMRPVTKAQIYSVKQKLTSKSSRSNVRRP
Ga0182151_11162862	3300015337	Switchgrass Phyllosphere	VNKSRRGDNDAPGSQSLDKPDNF*IYLNEATAMRPVAKAQI
Ga0182151_11256721	3300015337	Switchgrass Phyllosphere	VNKSRRDDGDAPGSQSLDEFDNF*IDLNEATAMNPVAKAQIYSVKQKLTSKSSRSNVRRR*S
Ga0182151_11510161	3300015337	Switchgrass Phyllosphere	VNKSRQDDSDAPGSQSLDKLDNF*IDLNEATAMRPVAKAQIY
Ga0182137_11089251	3300015338	Switchgrass Phyllosphere	VNKSRRDDIDTPGSQSLDKFDNF*IDLNEATVMRPVAK
Ga0182137_11444521	3300015338	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSQDKLDNF*IDLNEATAMRPEAKAQIYSVNEN
Ga0182149_11294101	3300015339	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLGKLDNF*IDLNEATAMRPV
Ga0182133_11195901	3300015340	Switchgrass Phyllosphere	VNKSRRDDIDTPGSQSLDKLDNF*IDLNEATVMRPVAKAQI
Ga0182133_11617411	3300015340	Switchgrass Phyllosphere	VNKSRRDDSDAPRNQSLDKLDNFLIDLNEATAMRPVAKAQIYSVKQKLTSKSSCSNVR
Ga0182115_11018452	3300015348	Switchgrass Phyllosphere	VNKSRRDDNNAPGSQSLNQLDNF*IDLNEATAMRPVAKAQIYSVKQK
Ga0182115_12545251	3300015348	Switchgrass Phyllosphere	MNKSRRDDSDAPRSQSLDKLDNF*IYLNEATAMRPVAKAQIYSVKQKLTSKS
Ga0182185_11341701	3300015349	Switchgrass Phyllosphere	VNKSR*DDSDAPGSQNLDELDNF*IDLNEATAMRPIAKAQIYSVKRKLTSKLSRSNVRRPGST*KN
Ga0182185_12590211	3300015349	Switchgrass Phyllosphere	VNKFRRDDSDTPGSQSLDKLDNF*IDLNEATAMRPEAKAQI
Ga0182185_12593562	3300015349	Switchgrass Phyllosphere	MNKSRRDDSDAPGSQSLDELDNF*IDLNEATAMRPVAKAQIYSVKRKLTSK
Ga0182163_12150261	3300015350	Switchgrass Phyllosphere	VNKSRRDDSDTPRSQSFDQLNNF*IDLNEATAMRPVAKAQIYSVKQ
Ga0182169_12767061	3300015352	Switchgrass Phyllosphere	VNKSRRDDSDAPESQSLDELDNF*IDLNEATAMRPIAKA
Ga0182179_10557511	3300015353	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDQLDNF*IDLNEATAMRLVAKAQIYSVKRKLTS
Ga0182167_13400202	3300015354	Switchgrass Phyllosphere	VNKSRRDDSDTPESQSLDELDNY*IDLNEATAMRPIAKAQIYSVK*KLTSK
Ga0182197_10968321	3300017408	Switchgrass Phyllosphere	VNKSRRDDSNTPGSQSLDKLDNFXIDLNKATAMRPKAKAQIYSVNE
Ga0182197_11216952	3300017408	Switchgrass Phyllosphere	VNKSRRDDSDAPRSQSLDELDNFXIDLNEATAMRPVAKAQIYSVKXK
Ga0182197_11285501	3300017408	Switchgrass Phyllosphere	MNKYRRDDSDTPGSQSLDELDNFXIDLNKATAMRPVAKAQIYSIKQKLTSKSSRSNVR
Ga0182199_11083641	3300017412	Switchgrass Phyllosphere	VNKSRXDDSDTLRSQSLDKLDNFXIDLNETTAMRPVAKAQIYSVKRK
Ga0182213_12106921	3300017421	Switchgrass Phyllosphere	LVNKSRRDNSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVK
Ga0182201_10417741	3300017422	Switchgrass Phyllosphere	VNKSRRDDRDAPGSQGLDKLDNFXIDLNEATAIRPVAKAQIYSVK
Ga0182196_10788551	3300017432	Switchgrass Phyllosphere	VNKSRRDNSDAPRSQSLDKLDNFXIDLNEATAMRPVAKAQ
Ga0182196_10810721	3300017432	Switchgrass Phyllosphere	VNKSKXDNSNAPGSQSLDKLDNFXIDLNEATTMHPVAK
Ga0182196_11213351	3300017432	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSLDKLDNFXIDLNESTAIRPVAKTQIY
Ga0182194_11006441	3300017435	Switchgrass Phyllosphere	VNKSRRDDSDTPGGQSLYKLDNFXIDLNEATTMRPEAKAQIYSVNEN
Ga0182200_10654562	3300017439	Switchgrass Phyllosphere	VNKSRQDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQI
Ga0182200_11626471	3300017439	Switchgrass Phyllosphere	EFVNKSRRDNSDTPGSQSLDQLDNFLIDLNEATAMRPIAKAQIYSVKRKLTSKSSRSNVRRP
Ga0182214_11167881	3300017440	Switchgrass Phyllosphere	VNKSRQDNSDAPESQSLDKLDNFXIDLNEATAMRPVAKAQIYS
Ga0182198_11543662	3300017445	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKTQIYSVKR
Ga0182212_11157292	3300017691	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSLDKLDNFXIDLNQATAMRLEAKTQIYSVNEN
Ga0182178_10067951	3300020023	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVKQKLT
Ga0182178_10183291	3300020023	Switchgrass Phyllosphere	VNKYRRDDSDAPGSQSLDELDNFXIDLNEATAMRPVAKAQIYSVKXKLTS
Ga0268328_10294651	3300028050	Phyllosphere	VNKSRRDNSDAPGSQSLDKLDNFXIDLNEATAMCPVAKAEIYSV
Ga0268330_10055121	3300028056	Phyllosphere	VNKSRRDDSDAPGSQSLDQLDNFXIDLNEATAMRLVAKAQIYLVKRKL
Ga0268332_10771251	3300028058	Phyllosphere	MNKSRRDDSDAPGSQSLDELDNFXIDLNEATAMRPVAKA
Ga0268326_10089821	3300028141	Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVKRKLTSKSSR
Ga0268308_10310301	3300028151	Phyllosphere	VNKSRRDDSDAPRSQSLDKLDNFXIDLNEATAMRPVAK
Ga0268336_10180881	3300028152	Phyllosphere	VNKSRRNDSDTPGSQSLDKLDNFXIDLNEATAMRLEAKAQIYSVNKNLPA
Ga0268316_10218291	3300028253	Phyllosphere	VNKSRRDDSDVPGSQSLDKLDNFXIDLNEATTMRP
Ga0268304_10149851	3300028256	Phyllosphere	VNKSRRDDSDAPGSQSLDQLDNFXIDLNEATAMRLVAKAQIY
Ga0268315_10186251	3300028472	Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVCKT
Ga0214503_11888321	3300032466	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVK
Ga0214491_10367793	3300032469	Switchgrass Phyllosphere	VNKSRRDDSDTPGNQNLDKLDNFXIDLNEATAMRPVAKAQIYS
Ga0214499_12278872	3300032697	Switchgrass Phyllosphere	VNKSRRDDNDAPGSQSLDKLDNFXINLNEATAMRPVAKAQIYSVKQKLTS
Ga0214494_10794961	3300032699	Switchgrass Phyllosphere	VNKSRRDDNDAPESQSLDNNNFXIDLNEATTMRPVA
Ga0314745_10023468	3300032812	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSLDKLDNFLIDLNEATAMRSEAKTHIYSVNKNLPADQVARM
Ga0314745_10603851	3300032812	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVKRK
Ga0314735_11062481	3300032824	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPV
Ga0314739_10423722	3300032913	Switchgrass Phyllosphere	VNKSRRDDSDAPGIQSLDELDNFXIDLNEATAMRPVAKAQIYSVKRKL
Ga0314750_10402382	3300032914	Switchgrass Phyllosphere	VNKSIRDDSDAPGSQSLDKLDNFLIDLNEATAMRPVAKTQIYSVKRKLTS
Ga0314741_11262521	3300032934	Switchgrass Phyllosphere	VNKSRRDDSDAPGSQSLDKLDNFXIDLNEATAMRPVAKAQIYSVKXKL
Ga0314738_10721091	3300032959	Switchgrass Phyllosphere	VNKSRQDDNDTPGSQSLDKLDIFXKDLNEATAMRP
Ga0314759_12750861	3300033535	Switchgrass Phyllosphere	VNKSRRDDSDTPGSQSLDKLDNFXIDLNEATAMRSEAKTQIYS