Basic Information | |
---|---|
Family ID | F091230 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 56 residues |
Representative Sequence | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKY |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 32.71 % |
% of genes from short scaffolds (< 2000 bps) | 99.07 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (53.271 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (81.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (82.243 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (81.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.50% β-sheet: 0.00% Coil/Unstructured: 77.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF02992 | Transposase_21 | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 53.27 % |
All Organisms | root | All Organisms | 46.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005543|Ga0070672_100535718 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1015 | Open in IMG/M |
3300005719|Ga0068861_101125313 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 756 | Open in IMG/M |
3300005840|Ga0068870_10355214 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 941 | Open in IMG/M |
3300009098|Ga0105245_10502678 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 1228 | Open in IMG/M |
3300009148|Ga0105243_10728520 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 970 | Open in IMG/M |
3300009176|Ga0105242_11382685 | Not Available | 731 | Open in IMG/M |
3300013296|Ga0157374_11807728 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 636 | Open in IMG/M |
3300013297|Ga0157378_12156530 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 608 | Open in IMG/M |
3300013297|Ga0157378_13028403 | Not Available | 521 | Open in IMG/M |
3300013297|Ga0157378_13028849 | Not Available | 521 | Open in IMG/M |
3300014486|Ga0182004_10040957 | Not Available | 2931 | Open in IMG/M |
3300014745|Ga0157377_10891992 | Not Available | 664 | Open in IMG/M |
3300015268|Ga0182154_1031767 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 637 | Open in IMG/M |
3300015268|Ga0182154_1051165 | Not Available | 559 | Open in IMG/M |
3300015268|Ga0182154_1066550 | Not Available | 518 | Open in IMG/M |
3300015268|Ga0182154_1073347 | Not Available | 503 | Open in IMG/M |
3300015269|Ga0182113_1053155 | Not Available | 606 | Open in IMG/M |
3300015269|Ga0182113_1065863 | Not Available | 568 | Open in IMG/M |
3300015269|Ga0182113_1071647 | Not Available | 553 | Open in IMG/M |
3300015274|Ga0182188_1031492 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 602 | Open in IMG/M |
3300015274|Ga0182188_1045215 | Not Available | 549 | Open in IMG/M |
3300015275|Ga0182172_1018458 | Not Available | 747 | Open in IMG/M |
3300015275|Ga0182172_1028750 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 665 | Open in IMG/M |
3300015277|Ga0182128_1009584 | Not Available | 902 | Open in IMG/M |
3300015277|Ga0182128_1021702 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 725 | Open in IMG/M |
3300015279|Ga0182174_1071966 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 531 | Open in IMG/M |
3300015282|Ga0182124_1031520 | Not Available | 661 | Open in IMG/M |
3300015282|Ga0182124_1079277 | Not Available | 509 | Open in IMG/M |
3300015283|Ga0182156_1030351 | Not Available | 685 | Open in IMG/M |
3300015283|Ga0182156_1080632 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 516 | Open in IMG/M |
3300015283|Ga0182156_1085692 | Not Available | 506 | Open in IMG/M |
3300015286|Ga0182176_1022820 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 759 | Open in IMG/M |
3300015286|Ga0182176_1069365 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 538 | Open in IMG/M |
3300015287|Ga0182171_1027890 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 700 | Open in IMG/M |
3300015288|Ga0182173_1015421 | Not Available | 813 | Open in IMG/M |
3300015288|Ga0182173_1047467 | Not Available | 600 | Open in IMG/M |
3300015288|Ga0182173_1055737 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 573 | Open in IMG/M |
3300015289|Ga0182138_1044340 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 618 | Open in IMG/M |
3300015291|Ga0182125_1000813 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 1905 | Open in IMG/M |
3300015292|Ga0182141_1012193 | Not Available | 895 | Open in IMG/M |
3300015292|Ga0182141_1042038 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 638 | Open in IMG/M |
3300015294|Ga0182126_1081508 | Not Available | 529 | Open in IMG/M |
3300015294|Ga0182126_1093823 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 506 | Open in IMG/M |
3300015296|Ga0182157_1020582 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 805 | Open in IMG/M |
3300015296|Ga0182157_1097381 | Not Available | 512 | Open in IMG/M |
3300015298|Ga0182106_1067452 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 573 | Open in IMG/M |
3300015300|Ga0182108_1064859 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 587 | Open in IMG/M |
3300015302|Ga0182143_1046878 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 641 | Open in IMG/M |
3300015302|Ga0182143_1048449 | Not Available | 635 | Open in IMG/M |
3300015302|Ga0182143_1054613 | Not Available | 613 | Open in IMG/M |
3300015302|Ga0182143_1103853 | Not Available | 503 | Open in IMG/M |
3300015303|Ga0182123_1056494 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 593 | Open in IMG/M |
3300015303|Ga0182123_1067866 | Not Available | 562 | Open in IMG/M |
3300015303|Ga0182123_1071749 | Not Available | 553 | Open in IMG/M |
3300015303|Ga0182123_1075027 | Not Available | 546 | Open in IMG/M |
3300015304|Ga0182112_1034228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 702 | Open in IMG/M |
3300015305|Ga0182158_1083300 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 539 | Open in IMG/M |
3300015305|Ga0182158_1104310 | Not Available | 503 | Open in IMG/M |
3300015308|Ga0182142_1100366 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 525 | Open in IMG/M |
3300015314|Ga0182140_1076753 | Not Available | 573 | Open in IMG/M |
3300015321|Ga0182127_1031979 | Not Available | 764 | Open in IMG/M |
3300015321|Ga0182127_1043935 | Not Available | 695 | Open in IMG/M |
3300015321|Ga0182127_1049322 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 672 | Open in IMG/M |
3300015321|Ga0182127_1081094 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 578 | Open in IMG/M |
3300015321|Ga0182127_1085210 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 569 | Open in IMG/M |
3300015322|Ga0182110_1048187 | Not Available | 674 | Open in IMG/M |
3300015322|Ga0182110_1059610 | Not Available | 633 | Open in IMG/M |
3300015322|Ga0182110_1068139 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 608 | Open in IMG/M |
3300015322|Ga0182110_1077446 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 585 | Open in IMG/M |
3300015322|Ga0182110_1094388 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 549 | Open in IMG/M |
3300015323|Ga0182129_1110462 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 510 | Open in IMG/M |
3300015341|Ga0182187_1193991 | Not Available | 508 | Open in IMG/M |
3300015342|Ga0182109_1217561 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 507 | Open in IMG/M |
3300015343|Ga0182155_1072146 | Not Available | 757 | Open in IMG/M |
3300015343|Ga0182155_1186881 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 539 | Open in IMG/M |
3300015343|Ga0182155_1227339 | Not Available | 500 | Open in IMG/M |
3300015344|Ga0182189_1212101 | Not Available | 518 | Open in IMG/M |
3300015346|Ga0182139_1199482 | Not Available | 545 | Open in IMG/M |
3300015351|Ga0182161_1192823 | Not Available | 574 | Open in IMG/M |
3300015351|Ga0182161_1233285 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 531 | Open in IMG/M |
3300015355|Ga0182159_1168856 | Not Available | 691 | Open in IMG/M |
3300015355|Ga0182159_1214921 | Not Available | 623 | Open in IMG/M |
3300015355|Ga0182159_1277116 | Not Available | 558 | Open in IMG/M |
3300017407|Ga0182220_1078399 | Not Available | 552 | Open in IMG/M |
3300017407|Ga0182220_1093663 | Not Available | 524 | Open in IMG/M |
3300017409|Ga0182204_1071102 | Not Available | 591 | Open in IMG/M |
3300017409|Ga0182204_1082595 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 564 | Open in IMG/M |
3300017410|Ga0182207_1172456 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 506 | Open in IMG/M |
3300017417|Ga0182230_1114733 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 505 | Open in IMG/M |
3300017420|Ga0182228_1056101 | Not Available | 683 | Open in IMG/M |
3300017424|Ga0182219_1079927 | Not Available | 600 | Open in IMG/M |
3300017427|Ga0182190_1058420 | Not Available | 716 | Open in IMG/M |
3300017436|Ga0182209_1041724 | Not Available | 790 | Open in IMG/M |
3300017438|Ga0182191_1112802 | Not Available | 593 | Open in IMG/M |
3300017442|Ga0182221_1079389 | Not Available | 638 | Open in IMG/M |
3300017443|Ga0182193_1134083 | Not Available | 575 | Open in IMG/M |
3300017680|Ga0182233_1028550 | Not Available | 984 | Open in IMG/M |
3300017680|Ga0182233_1044466 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 781 | Open in IMG/M |
3300017684|Ga0182225_1134174 | Not Available | 515 | Open in IMG/M |
3300025907|Ga0207645_10353771 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 983 | Open in IMG/M |
3300025926|Ga0207659_10851797 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 783 | Open in IMG/M |
3300025927|Ga0207687_10535444 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 981 | Open in IMG/M |
3300025934|Ga0207686_10232007 | Not Available | 1339 | Open in IMG/M |
3300025938|Ga0207704_10631361 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 880 | Open in IMG/M |
3300025940|Ga0207691_10219610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 1648 | Open in IMG/M |
3300026078|Ga0207702_10513482 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1169 | Open in IMG/M |
3300026142|Ga0207698_12260705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 556 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 81.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070672_1005357182 | 3300005543 | Miscanthus Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLYTKKY* |
Ga0068861_1011253132 | 3300005719 | Switchgrass Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0068870_103552142 | 3300005840 | Miscanthus Rhizosphere | MILAIFAWAEDRIPIPSMGFGIGDKLADTMHVLLVHSGQMHPLSIHLCTKKILRQ* |
Ga0105245_105026782 | 3300009098 | Miscanthus Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADVMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0105243_107285201 | 3300009148 | Miscanthus Rhizosphere | MKVPMILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0105242_113826852 | 3300009176 | Miscanthus Rhizosphere | VPMILVIFAWAEDRVPIPSMGFGIGDKLADAIHVPIVRSGQMHPLSIHLCTKKF* |
Ga0157374_118077281 | 3300013296 | Miscanthus Rhizosphere | LIPAIFAWAEDRVPIPSMAFGIGEKLADAMLVSLVCSGQMHPLDPSLHKKILRQ* |
Ga0157378_121565302 | 3300013297 | Miscanthus Rhizosphere | LTKVSLIFAIFAWAEDRVLIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHHCTKKY* |
Ga0157378_130284031 | 3300013297 | Miscanthus Rhizosphere | MKVPLILAIFAWAEDMVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLYIKKYETVITKN* |
Ga0157378_130288491 | 3300013297 | Miscanthus Rhizosphere | VRSYRLNLMKVPLILPIFAWAEDRVPIPSMGFCIGDKLADAMHVPLVRSGLSAHKNAETIITKN* |
Ga0182004_100409571 | 3300014486 | Root | MGREDGVSILNIGFGIGDKVADAKYVPLVHSGQMHPLSLHLYTQKKKLRLHAT* |
Ga0157377_108919921 | 3300014745 | Miscanthus Rhizosphere | NQVRSYRLNLTKVPMILAIFAWAEVRVPIPNMGFGIDDKLADAMRVLLVRSGQMHPRSIHLCTKKY* |
Ga0182154_10317671 | 3300015268 | Miscanthus Phyllosphere | MKVPLILAIFAWTEDMVPIPSMGFGIGDKLVGAMYVPLVRTGQMHPLSIHLCTKKY* |
Ga0182154_10511651 | 3300015268 | Miscanthus Phyllosphere | MAEDRVPIHSMGFGIGDKLADAMHVLLVRSGQMHPLSIHLCIKKILRQ* |
Ga0182154_10665501 | 3300015268 | Miscanthus Phyllosphere | ILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVCSGQMHPLSIHLCSKKY* |
Ga0182154_10733471 | 3300015268 | Miscanthus Phyllosphere | MILTIFAWAEDMVPIPSMDFGIGDKLADAMHVPLIRSGQMHPLSIHLCTKKY* |
Ga0182113_10531551 | 3300015269 | Miscanthus Phyllosphere | MKVLMILAIFAWVEDRVLIPSMGFGIGYKLVDAMHVPLVRSGQMQPLSIRLYTKKY* |
Ga0182113_10658631 | 3300015269 | Miscanthus Phyllosphere | MILAIFAWEEDRVPIPSMGFGIGDKLADAMHVPLVRLGQMHPLSIHLCTKKY* |
Ga0182113_10716471 | 3300015269 | Miscanthus Phyllosphere | ILAIFAWAEDRVPIPSMGFGIGDKLADVMHVLLVRLGQMHPLSIHFCTKKY* |
Ga0182188_10314921 | 3300015274 | Miscanthus Phyllosphere | MILAIFAWAEDRVPVPSMGFGIGDKLADAMHVPLVRLGQMNLLSIHLCTKKY* |
Ga0182188_10452151 | 3300015274 | Miscanthus Phyllosphere | MKVLLILAIFVWAEDRVPIPSMSFSIGDKLADAMHVPLVRSGQMHPLSIHLCTQKILRQ* |
Ga0182172_10184581 | 3300015275 | Miscanthus Phyllosphere | PLIHAIFAWAKDRVPIPSMAFGIGEKLADANHVPLVRSGPIHPL* |
Ga0182172_10287501 | 3300015275 | Miscanthus Phyllosphere | MILAIFAKAENRVPIPSMGFGIGDKLADAMHVPLVHSGQIHSLSIHLCTKNNETVITKKL |
Ga0182128_10095841 | 3300015277 | Miscanthus Phyllosphere | LFSLIHAIFAWAEDRVLIPSMGFDIGDKLTDGMHVPLIRSGQIHPLSIHLCTKTY* |
Ga0182128_10217022 | 3300015277 | Miscanthus Phyllosphere | MILAIFAWAEDRVPIPSVGFGIGDKLADAMHVPLVRSGQMHPLSIHLCIKKILRQ* |
Ga0182174_10719661 | 3300015279 | Miscanthus Phyllosphere | MKVPLILAIFAWAEDRVPIPSMGFGIGDKLVDAMHVPLVRSGQMHPLSIYLCTKNTETVITKN* |
Ga0182124_10315201 | 3300015282 | Miscanthus Phyllosphere | LNLTKVSMILAIFAWAEDRVPIPNMGFGIGDKLADAMHVLLVRSGQMHPLSIHLCTTKY* |
Ga0182124_10792771 | 3300015282 | Miscanthus Phyllosphere | RLNLTKVPLILAIFAWAEDMIPILSMGFDIGDKLADAMHVPLVRSGQMHPLSIHLCTKKILRQ* |
Ga0182156_10303512 | 3300015283 | Miscanthus Phyllosphere | MILAIFAWAEDRVRIPSIGFGIGDKLANAMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0182156_10806321 | 3300015283 | Miscanthus Phyllosphere | MILAIFALAEDRVPIPSMGFGIGDKLADAMHVPLVCSGYMHPLSIHLCTKKY* |
Ga0182156_10856921 | 3300015283 | Miscanthus Phyllosphere | LTKVPLILAIFAWAEDKVPILSMGFDIGDKLADAMHVPLVHSGQMHPLSIHLCTKKY* |
Ga0182176_10228202 | 3300015286 | Miscanthus Phyllosphere | MKVPMILAIFAWAEDRVLIPSMGFGIGDKLADVMHVSLVCSGQMHPLSIHLCTKKY* |
Ga0182176_10693651 | 3300015286 | Miscanthus Phyllosphere | MKVPLILAIFAWAKDSVPIPSMGFGIGDKLADAMHVPLVYSGQMHPLSIHLCTKKILR* |
Ga0182171_10278902 | 3300015287 | Miscanthus Phyllosphere | MKVPLILAIFPWAEDRVPIPSMGFGIDDKLADTMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0182173_10154211 | 3300015288 | Miscanthus Phyllosphere | NLTKVPMILAIFAWAEDRVPIPSMDFGIGDKLTDAMHVPLVRSGQMHRLSIHLCTKKY* |
Ga0182173_10474671 | 3300015288 | Miscanthus Phyllosphere | LTKVPMILAIFAWAEDRVRIPSMGFRIGDKLADAMYVPLVRSGQMHPLSIHL* |
Ga0182173_10557371 | 3300015288 | Miscanthus Phyllosphere | MILAIFAWAEDRVRIPSMGFRIGDKLADAMHVPLVRLGQMHPLSIHLCTKKY* |
Ga0182138_10443402 | 3300015289 | Miscanthus Phyllosphere | MKVPLILAIFAWAEDRVSIPSMGFGIGDILADVMHIPLFRLGQIHPLSIHLYTKNTETVITK |
Ga0182125_10008131 | 3300015291 | Miscanthus Phyllosphere | MILAIFAWAEDRVPIPSMGFGIGDKLVDAMHVPLVRLGQMHPLSIHLCTKKY* |
Ga0182141_10121931 | 3300015292 | Miscanthus Phyllosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVCSGQMHPLSIHLCTKKY* |
Ga0182141_10420382 | 3300015292 | Miscanthus Phyllosphere | MILAIFAWPEDRVPIPSMGFGIGDKLADVMHVPLVRLGQMHPLSIHLCTKNTKTVITKN* |
Ga0182126_10815081 | 3300015294 | Miscanthus Phyllosphere | MKVPMILAIFAWAEDRVPIPSMGFGISDKLADAMHVPLVHSGQMHPLSIHLYTKKY* |
Ga0182126_10938232 | 3300015294 | Miscanthus Phyllosphere | MKVSLILAIFAWAEDRVPIPSMGFDIGDKLADAMHVLLVCSGQMHPLSIHLCTKKILRQ* |
Ga0182157_10205822 | 3300015296 | Miscanthus Phyllosphere | MKVPIILAIFAWAEDRVSIPSMGFGIGDKLANAMHVPLICSEQMHLLSIYVCTKKY* |
Ga0182157_10973811 | 3300015296 | Miscanthus Phyllosphere | LTKVPLILAIFAWAEDMVPIPSMGFGIGDKLADAMHAPLVHSGQMHPLSIHLFTKKY* |
Ga0182106_10674521 | 3300015298 | Miscanthus Phyllosphere | MKVPMILVIFAWAEDKVPIPSMGFGIGDKLADAMHVSLVRSGQMHPLSIHLCTKKY* |
Ga0182108_10648592 | 3300015300 | Miscanthus Phyllosphere | MKVPMILAIFAWAEDGVNIPSMGFGIGDKLADAMHVPLVRSGQMHPLLIHLCTKKY* |
Ga0182143_10468782 | 3300015302 | Miscanthus Phyllosphere | MILAIFAWAEDRVPIPSMGFGVGDKLADVMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0182143_10484493 | 3300015302 | Miscanthus Phyllosphere | LTKVPLILAIFAWAEDRVPTPNMGFGIGDKLADAMHVPLERLGQMHPLSIHLCTKKY* |
Ga0182143_10546131 | 3300015302 | Miscanthus Phyllosphere | IFAWVEDRVPIPSMGFGVGEKLADANHVSLVRSGPIHPLSIHLCTTKY* |
Ga0182143_11038531 | 3300015302 | Miscanthus Phyllosphere | LSSFPFIHAIFAWAEDMVPIPSMGFGIGDKLADAMHVPLVRSGQMHLLSIHLYTKNIET |
Ga0182123_10564941 | 3300015303 | Miscanthus Phyllosphere | LILAIFAWAEDRVPNPSMGFGICDKLADAMHVPLVRSGQMHPLSIHLCTKNT |
Ga0182123_10678661 | 3300015303 | Miscanthus Phyllosphere | TKVSLILTIFAWAEDRVPISSMSFGIGDKLADAMHVPLIRSGQMHPLSIHLCKKNTETVITKN* |
Ga0182123_10717492 | 3300015303 | Miscanthus Phyllosphere | LNLTKVPMILAIFAWAEDRVRIPSMGFGIDDKLADAMHVPFVHSGQMHPLSISY* |
Ga0182123_10750272 | 3300015303 | Miscanthus Phyllosphere | MKVLMILAIFAWVEDRIPILSMGFGIGDKLVDAMHVPLVRSGQMHPLSIHLYTKNNETVITKN* |
Ga0182112_10342281 | 3300015304 | Miscanthus Phyllosphere | MKVPLILAIFAWAEDRVSIFSMGFGIDDKLANAMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0182158_10833002 | 3300015305 | Miscanthus Phyllosphere | LILAIFAWVEDRIPILSMGFGIGDKLVDAMHVPLVRSGQMHPLSIHLYTKNNETVITKN* |
Ga0182158_11043102 | 3300015305 | Miscanthus Phyllosphere | AIFAWAEDRVSIPSMGFGIDDKLADVMHVPLVCSGQMHPLSIHLCTKKY* |
Ga0182142_11003662 | 3300015308 | Miscanthus Phyllosphere | LIKVPLILAIFALAEDRVPIRSMGFGIGDKLADAMHVPLVRLGQMHPLSIHLCTKNTETVITKN* |
Ga0182140_10767532 | 3300015314 | Miscanthus Phyllosphere | MKAPLILAIFAWAEDRVPIPSMGFGIDDKLADAMHVPLVRSGQMHPLSIHLCTKNNEIVITKN* |
Ga0182127_10319791 | 3300015321 | Miscanthus Phyllosphere | AIFAWVEDRVPILSMGFGIGEKLAGALHVLVVHLGQIHPLLIHLCTTKY* |
Ga0182127_10439352 | 3300015321 | Miscanthus Phyllosphere | ILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVHSGQMHPLSIHLYTKNSKTIITKN* |
Ga0182127_10493221 | 3300015321 | Miscanthus Phyllosphere | MKVPMILAIFVWAEDRVHIPNMGFGIGDKLADAMNVPLVRSRQMHSLSIHLGTKKY* |
Ga0182127_10810942 | 3300015321 | Miscanthus Phyllosphere | MILEIFAWAEDRVPIPSMGFCIDDKLADAMHVPLVRSGQMHPLSIHLCTKKY* |
Ga0182127_10852102 | 3300015321 | Miscanthus Phyllosphere | LILAIFTWAEDRVPILSMGFEMGEKQADAMNVLFIHSGQMHPPSIHFCKKKNIKTV |
Ga0182110_10481871 | 3300015322 | Miscanthus Phyllosphere | MKVPLILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCAKNTETVITKN* |
Ga0182110_10596101 | 3300015322 | Miscanthus Phyllosphere | LAIFAWAEDRVPISSMGFGIGDKLDDAMHVPLVRSGQMHPLSIHLCTKKILTQ* |
Ga0182110_10681392 | 3300015322 | Miscanthus Phyllosphere | MKVPMILAIFAWAEDKVPISSKGFGIGDKLADAMHVPLVCSGQMHPLSIHLCTKKY* |
Ga0182110_10774461 | 3300015322 | Miscanthus Phyllosphere | MILAIFAWAEDRVPIPSMGFGVGDKLVDAMHVPLVCSGQMHRLSIHLCTKKY* |
Ga0182110_10943882 | 3300015322 | Miscanthus Phyllosphere | MILAIFAWADDRVPIPSMGFGIDDKLVNAMHVPLVRSGQMHHLLIHLCTKKILR* |
Ga0182129_11104621 | 3300015323 | Miscanthus Phyllosphere | MILAIFAWVEDRVPIPSLGFGIGDKLADAMYVTLVRSGQMHPLSIHLCTKNTETVITKN* |
Ga0182187_11939912 | 3300015341 | Miscanthus Phyllosphere | MIHAIFAWVEDRVPISSMGFGIGDKLADAMHVPLVHSRHMHPLSIHLCTKKY |
Ga0182109_12175611 | 3300015342 | Miscanthus Phyllosphere | LTKVHLILAIFAWAEDKVPIPSMGFDIGDKLADAMHVSLVRSGQMHPLLIHLYTKKY* |
Ga0182155_10721461 | 3300015343 | Miscanthus Phyllosphere | MILAIFAWAEDRVSIPSTGFDIGDKLADAMHVPLVCSGQMHPLSIHLSTKKILRQ* |
Ga0182155_11868812 | 3300015343 | Miscanthus Phyllosphere | MKVSFILAIFAWAEDSVPIPNMGFDIGDKLADAMHVLLVRSGQMHPLSIHLC |
Ga0182155_12273391 | 3300015343 | Miscanthus Phyllosphere | MKVPLIIAIFSWAEDTVPIPSMGFGIGDKLANAMHVPLVRSGQMHPLSIHLCTQKILR* |
Ga0182189_12121012 | 3300015344 | Miscanthus Phyllosphere | TKVPLILAIFAWAEDRVPIPSMGFGIGDKLADTMHVPLVHSRQMHPLLIHLCTKKY* |
Ga0182139_11994821 | 3300015346 | Miscanthus Phyllosphere | LTKVPLILAIFAWAEDRVFIPSMGFGIGDKLADAMHVLLVRSGQMHPLSIHLCTKKY* |
Ga0182161_11928231 | 3300015351 | Miscanthus Phyllosphere | MTVPLILAIFAWAEDRVPIPSIGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKILRQ* |
Ga0182161_12332851 | 3300015351 | Miscanthus Phyllosphere | MILAIFAWADDRVPIPSMGFGIGDKLADAMHVPFVCSGQMHPLSIHLFTKNTETVITKRSFVWRVIGFN* |
Ga0182159_11688562 | 3300015355 | Miscanthus Phyllosphere | MIHAIFAWAEDGVFIPSIGFGIGEKLVDAKHVSLVRSGQIHPLSIHLC |
Ga0182159_12149211 | 3300015355 | Miscanthus Phyllosphere | QVQLYRLNLTKVSLILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRLGQMHPLSIHLCTKKY* |
Ga0182159_12771161 | 3300015355 | Miscanthus Phyllosphere | MFAWTEDRVPIPSMGFGIGDKLADAMHVPLICLGQMRPLSIHLRTKKILKQ* |
Ga0182220_10783991 | 3300017407 | Miscanthus Phyllosphere | FAWAEHRVPIPSMGFGIGDKLADVMHVLLVRPGQMHPLSIHLCTKKY |
Ga0182220_10936631 | 3300017407 | Miscanthus Phyllosphere | MKVHLILAIFAWAEHRIPIPSMGFGIGDKLADAMHVPLVRLGQMHPLSIHLCTQKY |
Ga0182204_10711022 | 3300017409 | Miscanthus Phyllosphere | MILPIFVWAEDRVPIPSMGFGIDDKLADAMHAPLVRSGQMHPLSIHLCTKKY |
Ga0182204_10825951 | 3300017409 | Miscanthus Phyllosphere | LIKVSLILAIFAWAEDRVLIPSMGFDIGDKLADAMHVPLVHSGQMHPLSIHLCTKKY |
Ga0182207_11724561 | 3300017410 | Miscanthus Phyllosphere | MILAIFAWAEDMVSIPSMGFGIDDKLADTMHVPLVRSGQMHPLSIHLCTKKY |
Ga0182230_11147332 | 3300017417 | Miscanthus Phyllosphere | MKVPLILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVHWGQMHPLSIHLCTKKY |
Ga0182228_10561012 | 3300017420 | Miscanthus Phyllosphere | LIHAIFAWAEDRVSIPSMGFGIGHKLVDAMHVPLARSVQMHPLPIHLLTKKY |
Ga0182219_10799272 | 3300017424 | Miscanthus Phyllosphere | MILAIFAWAEDRVPIPSMGFGIGDKLSDAKHVLLVHLGQMHPLSIHLCTKKY |
Ga0182190_10584201 | 3300017427 | Miscanthus Phyllosphere | MKVPMILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKY |
Ga0182209_10417242 | 3300017436 | Miscanthus Phyllosphere | MILAIFAWAEDMFPIPSMGFGISDKLADAMHVPLVRSGQMHPLSIHLCTKNTATVITKN |
Ga0182191_11128021 | 3300017438 | Miscanthus Phyllosphere | YRLNLMKVPMILAIFAWAEDRVPIPSMGFGIGDKLADVMHVPLVCSGQMHPHSINLCTKK |
Ga0182221_10793891 | 3300017442 | Miscanthus Phyllosphere | MKVPLILAIFAWAEDRVPIPSMGFGISDKLANAMHVPLVRSGQMHPLSIHL |
Ga0182193_11340831 | 3300017443 | Miscanthus Phyllosphere | PFPLIHVIFAWAEDRVRIPSMGFGIGEKLTDANHVPLVRSGPIHSLSIHLYTTKY |
Ga0182233_10285502 | 3300017680 | Miscanthus Phyllosphere | VPLILAIFAWVEDRVSIPSMGLGIGDKLADDMYVLLVRSGQMHPLSIHLCTKKH |
Ga0182233_10444661 | 3300017680 | Miscanthus Phyllosphere | MKIPMILVIFAWAEDMVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLS |
Ga0182225_11341742 | 3300017684 | Miscanthus Phyllosphere | VRSHRLNLIKVPFILAIFAWVEDRVPISNMSFGIGDKRADAMHVSLVRSGQMHPVSI |
Ga0207645_103537712 | 3300025907 | Miscanthus Rhizosphere | MKVPLILAIFAWVEDSVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKNTETVITKN |
Ga0207659_108517972 | 3300025926 | Miscanthus Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLANAMHVPLVYSGQMHPLSIHLCTKKY |
Ga0207687_105354442 | 3300025927 | Miscanthus Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKILRQ |
Ga0207686_102320071 | 3300025934 | Miscanthus Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVCSGQMHPLSIHLCTKKY |
Ga0207704_106313613 | 3300025938 | Miscanthus Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKY |
Ga0207691_102196101 | 3300025940 | Miscanthus Rhizosphere | MKVPMILAIFAWAEDMVPIPSMGFGIGDKLADAMHVPLVRSGQMHPLSIHLCTKKY |
Ga0207702_105134822 | 3300026078 | Corn Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADAMHVLLVCSGQMHPLPIHLYTKNTKTVITKN |
Ga0207698_122607052 | 3300026142 | Corn Rhizosphere | MILAIFAWAEDRVPIPSMGFGIGDKLADTMHVPFVRSGQMHPLSIHLCTKKY |
⦗Top⦘ |