Metagenome Family F091225

Basic Information
Family ID	F091225
Family Type	Metagenome
Number of Sequences	107
Average Sequence Length	40 residues
Representative Sequence	VAEAYNPYSVDDGYEDEEEEVAVAEWNWGKKTVMVPNP
Number of Associated Samples	58
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	50.96 %
% of genes near scaffold ends (potentially truncated)	53.27 %
% of genes from short scaffolds (< 2000 bps)	97.20 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Unclassified (55.140 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.392 % of family members)
Environment Ontology (ENVO)	Unclassified (95.327 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.327 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF03732	Retrotrans_gag	20.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
All Organisms	root	All Organisms	44.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
cellular organisms	root	All Organisms → cellular organisms	44.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	30.84 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	30.84 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	30.84 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	30.84 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	30.84 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	29.91 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	29.91 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	19.63 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	2.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	19.63 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	2.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	19.63 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.87 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	19.63 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.87 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	19.63 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.87 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	17.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.87 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.14 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	17.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.02 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.87 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009148\|Ga0105243_12264975	Not Available	580	Open in IMG/M
3300013297\|Ga0157378_12691361	Not Available	550	Open in IMG/M
3300014745\|Ga0157377_10670963	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	749	Open in IMG/M
3300014745\|Ga0157377_11336385	Not Available	562	Open in IMG/M
3300014745\|Ga0157377_11402600	Not Available	551	Open in IMG/M
3300015267\|Ga0182122_1073095	Not Available	501	Open in IMG/M
3300015268\|Ga0182154_1038528	Not Available	605	Open in IMG/M
3300015268\|Ga0182154_1044532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	581	Open in IMG/M
3300015268\|Ga0182154_1074349	Not Available	501	Open in IMG/M
3300015269\|Ga0182113_1076546	Not Available	542	Open in IMG/M
3300015269\|Ga0182113_1095556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	505	Open in IMG/M
3300015274\|Ga0182188_1046602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	544	Open in IMG/M
3300015275\|Ga0182172_1016727	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	767	Open in IMG/M
3300015275\|Ga0182172_1032885	Not Available	642	Open in IMG/M
3300015276\|Ga0182170_1059043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	546	Open in IMG/M
3300015277\|Ga0182128_1059591	Not Available	548	Open in IMG/M
3300015279\|Ga0182174_1055508	Not Available	574	Open in IMG/M
3300015279\|Ga0182174_1058326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	566	Open in IMG/M
3300015279\|Ga0182174_1072332	Not Available	530	Open in IMG/M
3300015281\|Ga0182160_1023921	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	717	Open in IMG/M
3300015281\|Ga0182160_1065042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	543	Open in IMG/M
3300015285\|Ga0182186_1056038	Not Available	566	Open in IMG/M
3300015285\|Ga0182186_1079942	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	509	Open in IMG/M
3300015286\|Ga0182176_1060685	Not Available	561	Open in IMG/M
3300015287\|Ga0182171_1047670	Not Available	605	Open in IMG/M
3300015287\|Ga0182171_1059643	Not Available	566	Open in IMG/M
3300015287\|Ga0182171_1083483	Not Available	512	Open in IMG/M
3300015291\|Ga0182125_1010906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	927	Open in IMG/M
3300015291\|Ga0182125_1024597	Not Available	743	Open in IMG/M
3300015291\|Ga0182125_1072899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	544	Open in IMG/M
3300015294\|Ga0182126_1064887	Not Available	566	Open in IMG/M
3300015295\|Ga0182175_1024079	Not Available	758	Open in IMG/M
3300015295\|Ga0182175_1025633	Not Available	745	Open in IMG/M
3300015296\|Ga0182157_1013586	Not Available	903	Open in IMG/M
3300015296\|Ga0182157_1016648	Not Available	854	Open in IMG/M
3300015296\|Ga0182157_1072965	Not Available	560	Open in IMG/M
3300015298\|Ga0182106_1050986	Not Available	623	Open in IMG/M
3300015298\|Ga0182106_1082635	Not Available	538	Open in IMG/M
3300015300\|Ga0182108_1049194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	638	Open in IMG/M
3300015300\|Ga0182108_1079605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	551	Open in IMG/M
3300015300\|Ga0182108_1085387	Not Available	539	Open in IMG/M
3300015300\|Ga0182108_1101490	Not Available	510	Open in IMG/M
3300015302\|Ga0182143_1068614	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	573	Open in IMG/M
3300015303\|Ga0182123_1026247	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	733	Open in IMG/M
3300015303\|Ga0182123_1089555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	518	Open in IMG/M
3300015304\|Ga0182112_1037905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	682	Open in IMG/M
3300015305\|Ga0182158_1045230	Not Available	646	Open in IMG/M
3300015307\|Ga0182144_1062339	Not Available	597	Open in IMG/M
3300015308\|Ga0182142_1063703	Not Available	604	Open in IMG/M
3300015314\|Ga0182140_1096571	Not Available	533	Open in IMG/M
3300015321\|Ga0182127_1088552	Not Available	562	Open in IMG/M
3300015321\|Ga0182127_1116749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	513	Open in IMG/M
3300015321\|Ga0182127_1120342	Not Available	508	Open in IMG/M
3300015323\|Ga0182129_1065892	Not Available	597	Open in IMG/M
3300015323\|Ga0182129_1076770	Not Available	571	Open in IMG/M
3300015343\|Ga0182155_1084845	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	716	Open in IMG/M
3300015343\|Ga0182155_1136036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	606	Open in IMG/M
3300015343\|Ga0182155_1197223	Not Available	528	Open in IMG/M
3300015344\|Ga0182189_1093054	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	703	Open in IMG/M
3300015344\|Ga0182189_1138161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	610	Open in IMG/M
3300015345\|Ga0182111_1185695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	560	Open in IMG/M
3300015345\|Ga0182111_1203110	Not Available	541	Open in IMG/M
3300015346\|Ga0182139_1181628	Not Available	566	Open in IMG/M
3300015346\|Ga0182139_1188725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	557	Open in IMG/M
3300015346\|Ga0182139_1222316	Not Available	522	Open in IMG/M
3300015347\|Ga0182177_1194932	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	553	Open in IMG/M
3300015351\|Ga0182161_1190962	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	576	Open in IMG/M
3300015355\|Ga0182159_1158599	Not Available	709	Open in IMG/M
3300015361\|Ga0182145_1135207	Not Available	568	Open in IMG/M
3300015361\|Ga0182145_1172580	Not Available	523	Open in IMG/M
3300015361\|Ga0182145_1194239	Not Available	502	Open in IMG/M
3300017404\|Ga0182203_1060233	Not Available	695	Open in IMG/M
3300017409\|Ga0182204_1082803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	564	Open in IMG/M
3300017409\|Ga0182204_1106380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	521	Open in IMG/M
3300017410\|Ga0182207_1114291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	584	Open in IMG/M
3300017410\|Ga0182207_1171703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	507	Open in IMG/M
3300017411\|Ga0182208_1110892	Not Available	528	Open in IMG/M
3300017413\|Ga0182222_1052120	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	609	Open in IMG/M
3300017415\|Ga0182202_1092806	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	574	Open in IMG/M
3300017415\|Ga0182202_1120473	Not Available	527	Open in IMG/M
3300017420\|Ga0182228_1030482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	870	Open in IMG/M
3300017420\|Ga0182228_1070009	Not Available	628	Open in IMG/M
3300017420\|Ga0182228_1076238	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	609	Open in IMG/M
3300017420\|Ga0182228_1101304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	550	Open in IMG/M
3300017420\|Ga0182228_1130761	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	500	Open in IMG/M
3300017425\|Ga0182224_1105217	Not Available	583	Open in IMG/M
3300017425\|Ga0182224_1135102	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	538	Open in IMG/M
3300017425\|Ga0182224_1145799	Not Available	524	Open in IMG/M
3300017427\|Ga0182190_1142159	Not Available	529	Open in IMG/M
3300017427\|Ga0182190_1153097	Not Available	515	Open in IMG/M
3300017430\|Ga0182192_1086799	Not Available	639	Open in IMG/M
3300017430\|Ga0182192_1154953	Not Available	523	Open in IMG/M
3300017436\|Ga0182209_1167572	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	508	Open in IMG/M
3300017438\|Ga0182191_1172658	Not Available	512	Open in IMG/M
3300017438\|Ga0182191_1174889	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	510	Open in IMG/M
3300017442\|Ga0182221_1123191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	557	Open in IMG/M
3300017443\|Ga0182193_1178275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	520	Open in IMG/M
3300017684\|Ga0182225_1089644	Not Available	584	Open in IMG/M
3300017686\|Ga0182205_1132853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	549	Open in IMG/M
3300017686\|Ga0182205_1157320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	517	Open in IMG/M
3300017690\|Ga0182223_1067744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	596	Open in IMG/M
3300017690\|Ga0182223_1082416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	564	Open in IMG/M
3300017690\|Ga0182223_1087587	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	555	Open in IMG/M
3300021060\|Ga0182232_1076298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	546	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.67%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.67%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.67%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.39%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F091225

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105243_122649752	3300009148	Miscanthus Rhizosphere	VAKAYNPYSVNDGYEDEEEEVATAEWNWGKKTVMVANP*
Ga0157378_126913611	3300013297	Miscanthus Rhizosphere	MAKAYNSYSVDDCYEDDDEEEVATAKWNWGKKTVMVPNP
Ga0157377_106709632	3300014745	Miscanthus Rhizosphere	VAEVYDPYSVDDGYEDEEEEVATAEWNWGKKTVMVPNP*
Ga0157377_113363852	3300014745	Miscanthus Rhizosphere	VAEAYNSYSVDDGYEDEEEEVAAAEWNWGKKSVMVPNPWKR*
Ga0157377_114026001	3300014745	Miscanthus Rhizosphere	MAEAYNPYSVDDGYEDEEEEVAAAGWNWGKKTVMVPNS*
Ga0182122_10730952	3300015267	Miscanthus Phyllosphere	VAEAYDPYSVDDGYEGEEEEVAVAEWNWGKKTVMVPNPWGRGVE
Ga0182154_10385282	3300015268	Miscanthus Phyllosphere	VAEAYNPYSVNDGYEDEEEEVATAEWNWGKKTIMVPNP*
Ga0182154_10445322	3300015268	Miscanthus Phyllosphere	VAEAYDPYSIDDGYEDEEEEVATAEWNWGKKTVMVPNPWERGIEE
Ga0182154_10743491	3300015268	Miscanthus Phyllosphere	NPYSIDDGYEHYKEKEVATAEWNWDKKTVMVPNP*
Ga0182113_10765461	3300015269	Miscanthus Phyllosphere	MAEAYNPYSVDDGYEDEEEVAMAEWNWCKKIVMVPNP*
Ga0182113_10955562	3300015269	Miscanthus Phyllosphere	VVEAYNPYPVNDNYEYEEEEVAAAEWNWGKMIVMVLNPWG
Ga0182188_10466022	3300015274	Miscanthus Phyllosphere	VAEAYNLYSVDDSYEDEEEVAVAELNWGKKIVMVPNP*
Ga0182172_10167271	3300015275	Miscanthus Phyllosphere	VAEAYDPYSVDDGYEDEEEEVAAAEWNWGNKTVMVPNPWGR*
Ga0182172_10328851	3300015275	Miscanthus Phyllosphere	MAEAYNPYSVDDGYEDDEEEEIATAEWNWGKKIVMVLNP*
Ga0182170_10590431	3300015276	Miscanthus Phyllosphere	MVEAYNPYSVDDGYEDDEKEEVAVAKWNWGKKAVMVPNPWGRGVEE
Ga0182128_10595911	3300015277	Miscanthus Phyllosphere	MAEAYNPYLVNDYYEDDEEEEVAAAEWNWGKKIVMVPN
Ga0182174_10555081	3300015279	Miscanthus Phyllosphere	MAKAYNPYSVNDGYKDNEEVVATAEWNWGKKTVMVSNP*
Ga0182174_10583261	3300015279	Miscanthus Phyllosphere	VAKAYDPYSVDDGYEDEDEEVAAAEWNWGKKTVMMPNPWGRGVDESYDFD
Ga0182174_10723321	3300015279	Miscanthus Phyllosphere	MAEAYNPYSVGDGYEDDEEEEVATAEWNWGKKTVMVPNP*
Ga0182160_10239211	3300015281	Miscanthus Phyllosphere	MSTSTIVAEAYNPYSVDDSYEDEEEEVVVAEWNWGKKTVMVSNP*
Ga0182160_10650423	3300015281	Miscanthus Phyllosphere	MAEAYNPYLVDDCYEDDEGGEDAAVEWNWGKKTVIVS
Ga0182186_10560381	3300015285	Miscanthus Phyllosphere	IAEAYNPYSVNDGDEDDEEKEIAVAEWNWGKKIVMVPNP*
Ga0182186_10799423	3300015285	Miscanthus Phyllosphere	VAEAYNSYSVDDGYEDEEEEVAMAEWNWSKKIVMVPNP*
Ga0182176_10606851	3300015286	Miscanthus Phyllosphere	VAEAFNPYSVNDGYEDEEEDVVAAEWNWGKRTVMV
Ga0182171_10476702	3300015287	Miscanthus Phyllosphere	VAEAYDPYSVDDGYEDEEEEVAAAEWNWGKKTVMVP
Ga0182171_10596432	3300015287	Miscanthus Phyllosphere	SSLGYDSNPYLVNDDDEEEEIATAKWNWGKKIVMVPNP*
Ga0182171_10834831	3300015287	Miscanthus Phyllosphere	VAEAYNPYPVDDGYEDEEEEVAAVEWNWGKNTVMVPNP*
Ga0182138_10382642	3300015289	Miscanthus Phyllosphere	MAEAHNPYSVDDDNEDNEKEEVVAAEWNWGKKTVMVPNPWGRGVEES
Ga0182125_10109061	3300015291	Miscanthus Phyllosphere	MVEAYNPYSVNDGYEDDEEEEVATAEWNWGKKMVMVSNP*
Ga0182125_10245972	3300015291	Miscanthus Phyllosphere	MVEAYNPYLVDDCYEDDEEEEVAMAKWNWGKKTVMVPNP*
Ga0182125_10728992	3300015291	Miscanthus Phyllosphere	MAEAYNSYSVDDSYEDEEEEVTTAEWNWSKKIIMVPNP*
Ga0182126_10648872	3300015294	Miscanthus Phyllosphere	MAEAYNPYLVNDSYEDDEEEEVAAAEWNWGKKLVMVSNP*
Ga0182175_10240791	3300015295	Miscanthus Phyllosphere	VAEAYNSYSVDDGYEDEEEEVAVVEWNWGKKTVMVPNPW
Ga0182175_10256332	3300015295	Miscanthus Phyllosphere	MAEAYNPYFVDDGYEDNKELEVATAEWNWGKKTVMVSNP*
Ga0182157_10135862	3300015296	Miscanthus Phyllosphere	VAKTYNPYSVDDGYEDEEEEVVVAEWNWGKKTVMVPNPWGRGVKES
Ga0182157_10166481	3300015296	Miscanthus Phyllosphere	VAEAYNPYSVNDSYEDEEEEVATTEWNWGKKTVMVPNP*
Ga0182157_10729652	3300015296	Miscanthus Phyllosphere	VAEAYDPYSVDDGYEDEEEEVAAAEWNWGKKTVMVPNPWERGV
Ga0182106_10509861	3300015298	Miscanthus Phyllosphere	MAEAYNPYLVDDCYENDEEEEVAMAKWNWGKKTIMVPNPW
Ga0182106_10826351	3300015298	Miscanthus Phyllosphere	MTEAYNPYSVDDGYEDDEEEEVATAEWNWGKKTVMVPNP*
Ga0182108_10491941	3300015300	Miscanthus Phyllosphere	MAEAYNPYSVNDSYEDDEEEDVAVAEWNRGKKTVMVPNPWGRGVE
Ga0182108_10796051	3300015300	Miscanthus Phyllosphere	MAEACNPYSVDDGYEDDEEEEVAVAEWNWGKKIVMVPNPWGRG
Ga0182108_10853872	3300015300	Miscanthus Phyllosphere	EAYDPYSVDDGYEDEEEEVAAAKWNWGKKTVMVPNP*
Ga0182108_11014902	3300015300	Miscanthus Phyllosphere	VAEAYNPYSVDDGYEDEEEEVAVAEWNWGKKTVMVPNP*
Ga0182143_10686141	3300015302	Miscanthus Phyllosphere	MAEAYDPYSVNDGYEDEEEEVAVAEWNLGKKTVMVPNP*
Ga0182123_10262471	3300015303	Miscanthus Phyllosphere	MAEAYNPYSVDDGYEDDEEEEVAAAEWNWDKKTVMVPNP*
Ga0182123_10895552	3300015303	Miscanthus Phyllosphere	VAEAYNPYLVDDGYEDEEEAVTVAEWNWGKKTVMVLNLWGRGV
Ga0182112_10379052	3300015304	Miscanthus Phyllosphere	MAKAYNPYLVDDNYEDDEEEVAVAKWNWGNKTVMVPNP*
Ga0182158_10452303	3300015305	Miscanthus Phyllosphere	VVEAYNPCPIIDGYEDEEEEVAVAEWNWGKKIVMVPN
Ga0182144_10623391	3300015307	Miscanthus Phyllosphere	VAEAYNPYSVNDGYKDNEEVLATAEWNWGKKRVMVPNPW*
Ga0182142_10637032	3300015308	Miscanthus Phyllosphere	MAEAYNSYSVDDSYEDDEEDVAATEWNWGKKMVMVSNP*
Ga0182140_10965711	3300015314	Miscanthus Phyllosphere	VAEAYNPYLVNDGYEDEEEEVTMAEWNWGKQIVMVPNP
Ga0182127_10885522	3300015321	Miscanthus Phyllosphere	MAKAYNPYSVDDCYEHDEEEEVAAAEWNWGKKIVMVPNP*
Ga0182127_11167491	3300015321	Miscanthus Phyllosphere	MAKAYNPYLVDDSYEDDEEEEVAAAEWNWGKKLVMVSNP*
Ga0182127_11203421	3300015321	Miscanthus Phyllosphere	MAEAYNPYSVDDDYEDDEEEVVVAAEWNWGKKTVMVPNPWER
Ga0182129_10658922	3300015323	Miscanthus Phyllosphere	MAEAYNPYSVDDDYEDGEEQEVAAIEWNWGKKTVMVPNPWGRGVEESNDF
Ga0182129_10767701	3300015323	Miscanthus Phyllosphere	MAEAYNPYSVDDSYEDDDEEDVAMAIWNWGKKTVMVPNP*
Ga0182155_10848451	3300015343	Miscanthus Phyllosphere	MAEAYNPYSVGDGYEDDEEEEVATAEWNWGKKTVMV
Ga0182155_11360362	3300015343	Miscanthus Phyllosphere	VAEAYNPYSVDDDYEDEEEEVAAAEWNWGKKTVMVPNP*
Ga0182155_11972232	3300015343	Miscanthus Phyllosphere	AETYNPYSVDDGYENDEEEEVATAEWNWGKKTVMVPNF*
Ga0182189_10930541	3300015344	Miscanthus Phyllosphere	KSTTMVEAYNPYSVDDCYEDDEEEVVMAEWNWGKKTVMVPNS*
Ga0182189_11381612	3300015344	Miscanthus Phyllosphere	VAEAYNPYSVDDGYEDEEEEVATAKWNWGKKIVMVPNP*
Ga0182189_11530122	3300015344	Miscanthus Phyllosphere	VAEAYNPYLVDDGYEDEEEEVAVAKWNWGKKIVMVPNPWGRGVEE
Ga0182111_11856952	3300015345	Miscanthus Phyllosphere	VAEAYNPYSVDDGYEEEEEEVATVEWNWGKKTVMVPNS*
Ga0182111_12031101	3300015345	Miscanthus Phyllosphere	VAEAYDPYSVDDGYQDEEEEVAAAEWNWGKKTVVVPNPWGRGVEES
Ga0182139_11816282	3300015346	Miscanthus Phyllosphere	VAEAYNPYSVNDGYEDEEEEVAMAEWNWDKKTVMVPNPWGKRSRGEL*
Ga0182139_11887251	3300015346	Miscanthus Phyllosphere	VAEAYNPYPVDDSYKEEEEEVAATEWNLGKKAVMVPN
Ga0182139_12223162	3300015346	Miscanthus Phyllosphere	VAEAYNSYSVDVGYEDEEEEVVAAEWNWDKNTIMVPNP*
Ga0182177_11949321	3300015347	Miscanthus Phyllosphere	MAEAYNPYSVDDSYEDEEEEVVVAEWNWGKKTVMVPNP*
Ga0182161_11909623	3300015351	Miscanthus Phyllosphere	VAEDYNPYSVDDGYEDEEEEVAAAKWNWGKKTVMVPNPWER
Ga0182159_11585991	3300015355	Miscanthus Phyllosphere	MSEAYNPYSVDDCYEDNEGEEVTAAEWNWGKKTLMVPNP
Ga0182145_11352071	3300015361	Miscanthus Phyllosphere	MAEAYNPYSIDDSYEDDEEEEVAAAEWNWGKKTVMVLNP*
Ga0182145_11725801	3300015361	Miscanthus Phyllosphere	MAKAYNPYSVDNCYEDDEEEEVAMDEWNWGKKIVMVLNPSGRG
Ga0182145_11942391	3300015361	Miscanthus Phyllosphere	VAKAYNPYSVNDGYEDKEEEVAVAEWNWGKNTVMVPNP*
Ga0182203_10602331	3300017404	Miscanthus Phyllosphere	VAKAYDPYSVDNGYEDEEEEVVVAEWNWGKKTVMMPNPWGKRVE
Ga0182204_10828032	3300017409	Miscanthus Phyllosphere	VAKADDPYSVDDGYEDEEEEVAVAEWNWGKKTVMVP
Ga0182204_11063803	3300017409	Miscanthus Phyllosphere	VAEVYNPYSVDDGYEDEEEEVAAAEWNWCKKTVMVPHPWGRGV
Ga0182207_11142911	3300017410	Miscanthus Phyllosphere	MAEAYNPYSVDDDYEDDEEEEVAMAEWNWGKKTVMVPNPWE
Ga0182207_11717031	3300017410	Miscanthus Phyllosphere	EAYNPYSVDDGYEDEEEEVTAAEWNWGKKTVMVPNP
Ga0182208_11108922	3300017411	Miscanthus Phyllosphere	MAEAYNPYLVDDSYEDDEEEEVAAAEWNWGKKLVMVSNP
Ga0182222_10521203	3300017413	Miscanthus Phyllosphere	VAEAYNPYSVDDGYEDEEEGIAAAEWNWGKKAVMVPNPWRKRSRGEL
Ga0182202_10928061	3300017415	Miscanthus Phyllosphere	MDEAYNPYSVDDGYEDEKEEEVVATEWKWGKKIVME
Ga0182202_11204731	3300017415	Miscanthus Phyllosphere	VAEAYDPYSVNDGYEDEEEEVGAAEWNWGKMIVMVPNPWGRG
Ga0182228_10304821	3300017420	Miscanthus Phyllosphere	MAKAYNPYSVDNNYEDDEEEEVVMAEWNWGKKTVMVLNP
Ga0182228_10700091	3300017420	Miscanthus Phyllosphere	VAEAYDPYSVDDGYEDEEEEVAAAECYWGKKAVMVPNPWGRG
Ga0182228_10762381	3300017420	Miscanthus Phyllosphere	TRFQKSAAIAETYNPYSIDDGYEDDEEGEVAAAEWNWGKKTVMVPNP
Ga0182228_11013041	3300017420	Miscanthus Phyllosphere	MAEAYNLYSVDDNYEDEEEEVVVAEWNWGKKTVMVPNPWGRG
Ga0182228_11307612	3300017420	Miscanthus Phyllosphere	VVEAYNPYSVNDSYEDEEEEVAVAEWNWGKKIVMVSNP
Ga0182224_11052172	3300017425	Miscanthus Phyllosphere	VAEAYNPYSVNDSYEDEEEVAADEWNWGKKTVMVPNPWGRGVEES
Ga0182224_11351021	3300017425	Miscanthus Phyllosphere	MAEAYNPYSVDDDYKDNEEEEVAMAEWNWGKKTVMVSNP
Ga0182224_11457991	3300017425	Miscanthus Phyllosphere	VVEAYDPYSVDDGYEDEEEEVATAEWNWGKKTVMVPNPWGR
Ga0182190_11421591	3300017427	Miscanthus Phyllosphere	MTEAYNPYSVDDNYEDDEEEEVVVAEWNWGKKTIMVPNP
Ga0182190_11530971	3300017427	Miscanthus Phyllosphere	LVAEGYNPYSIDDGYEDEEEEVAAGEWNWGKKTVMVPNPWGRGVEE
Ga0182192_10867991	3300017430	Miscanthus Phyllosphere	VVEAYNLYSVDDGYEDEEKEVAMTEWNWDKKTVMVSNP
Ga0182192_11549531	3300017430	Miscanthus Phyllosphere	MAKAYNPYSVDDGYEDNEEEVATAKWNWGKNTIMVPNPW
Ga0182209_11675721	3300017436	Miscanthus Phyllosphere	VAKAYDPYSVDDGYEDEEEEVAAAEWNWGKKTVMVPNPWG
Ga0182191_11726581	3300017438	Miscanthus Phyllosphere	MAEAYNPYSIDDGYEDYEEEVVAVTKWNWGKKTVMVPNPWERGIKESYDFD
Ga0182191_11748891	3300017438	Miscanthus Phyllosphere	TSVVEAYDPYSVDDGYEDEEEEVATAEWNWGKKTVMVPNPWGR
Ga0182221_11231912	3300017442	Miscanthus Phyllosphere	MVEAYNPYSVDDNYEDDDEEEVITAKWNRGKKIVMV
Ga0182193_11782752	3300017443	Miscanthus Phyllosphere	VAEAYNSYSVDDGYEDEEEEVAMAEWNWGKKTVMTPNP
Ga0182225_10896441	3300017684	Miscanthus Phyllosphere	VAEAYNPYPVDDGYEDEEEEVATAEWNWAKKTVMVPNP
Ga0182205_11328531	3300017686	Miscanthus Phyllosphere	VAEAYDPYSVNVGYEDEEEEVAIVEWNWGKKTVMVPNPWGRGVEE
Ga0182205_11573201	3300017686	Miscanthus Phyllosphere	KSTIVAEAYNPYSVDDGYEDEEEEVATAEWNWGKKTVMMPNP
Ga0182231_11022062	3300017689	Miscanthus Phyllosphere	MVEAYNQYSVDDGYNDEEEDVAAAEWNWGKKIVMVPNPWGRGVEE
Ga0182223_10677443	3300017690	Miscanthus Phyllosphere	VAEAYNPYSVDDGYEDEEEEVAVAEWNWGKKTVMVPNP
Ga0182223_10824161	3300017690	Miscanthus Phyllosphere	VAEAYDPYSVDDGYEDEEEEVAAAEWNWGKKTVMMPNPWGR
Ga0182223_10875871	3300017690	Miscanthus Phyllosphere	VAEAYNTYSIDDGYEDDEEEVAVAEWNWGKKTVMVSNPWGRGVKE
Ga0182232_10762982	3300021060	Phyllosphere	VAKAYNPYLVDDGYEDEEKEVAAAEWNWGKKTVMVPNP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign