| Basic Information | |
|---|---|
| Family ID | F091214 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRKPWVRPKELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.89 % |
| % of genes near scaffold ends (potentially truncated) | 31.78 % |
| % of genes from short scaffolds (< 2000 bps) | 74.77 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.794 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (42.056 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.654 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (97.196 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.87% β-sheet: 0.00% Coil/Unstructured: 39.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 6.54 |
| PF05257 | CHAP | 2.80 |
| PF07659 | DUF1599 | 1.87 |
| PF01930 | Cas_Cas4 | 1.87 |
| PF02467 | Whib | 1.87 |
| PF12705 | PDDEXK_1 | 1.87 |
| PF06210 | DUF1003 | 0.93 |
| PF05866 | RusA | 0.93 |
| PF03237 | Terminase_6N | 0.93 |
| PF01471 | PG_binding_1 | 0.93 |
| PF01844 | HNH | 0.93 |
| PF07120 | DUF1376 | 0.93 |
| PF00227 | Proteasome | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 1.87 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.93 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.93 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.21 % |
| Unclassified | root | N/A | 45.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c015549 | Not Available | 1237 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c007619 | Not Available | 1447 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1002359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13154 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1034369 | All Organisms → Viruses → Predicted Viral | 2057 | Open in IMG/M |
| 3300002091|JGI24028J26656_1003339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 2729 | Open in IMG/M |
| 3300002091|JGI24028J26656_1005585 | Not Available | 1871 | Open in IMG/M |
| 3300002091|JGI24028J26656_1018573 | Not Available | 712 | Open in IMG/M |
| 3300002092|JGI24218J26658_1006068 | Not Available | 2362 | Open in IMG/M |
| 3300002092|JGI24218J26658_1006286 | Not Available | 2302 | Open in IMG/M |
| 3300002092|JGI24218J26658_1024140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 793 | Open in IMG/M |
| 3300002092|JGI24218J26658_1037629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 567 | Open in IMG/M |
| 3300002092|JGI24218J26658_1037871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300002098|JGI24219J26650_1006571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2241 | Open in IMG/M |
| 3300002098|JGI24219J26650_1030197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300002098|JGI24219J26650_1041499 | Not Available | 531 | Open in IMG/M |
| 3300002301|JGI24891J29808_1004553 | Not Available | 1560 | Open in IMG/M |
| 3300002301|JGI24891J29808_1017427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300002307|JGI24890J29729_1018304 | Not Available | 1725 | Open in IMG/M |
| 3300002307|JGI24890J29729_1028118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300002933|G310J44882_10008525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3193 | Open in IMG/M |
| 3300002933|G310J44882_10024859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1494 | Open in IMG/M |
| 3300003783|Ga0007850_1000082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9513 | Open in IMG/M |
| 3300003809|Ga0007869_1027556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300003813|Ga0007879_1012475 | Not Available | 944 | Open in IMG/M |
| 3300003815|Ga0007856_1003826 | Not Available | 1207 | Open in IMG/M |
| 3300003815|Ga0007856_1006142 | Not Available | 868 | Open in IMG/M |
| 3300003815|Ga0007856_1008518 | Not Available | 703 | Open in IMG/M |
| 3300003823|Ga0007875_1014412 | Not Available | 928 | Open in IMG/M |
| 3300003852|Ga0031655_10012605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4268 | Open in IMG/M |
| 3300003852|Ga0031655_10385172 | Not Available | 521 | Open in IMG/M |
| 3300004686|Ga0065173_1073258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300004692|Ga0065171_1033228 | Not Available | 831 | Open in IMG/M |
| 3300004694|Ga0065170_1042396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300004770|Ga0007804_1036477 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300004770|Ga0007804_1045038 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300004770|Ga0007804_1050065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300004770|Ga0007804_1074606 | Not Available | 874 | Open in IMG/M |
| 3300004770|Ga0007804_1185432 | Not Available | 517 | Open in IMG/M |
| 3300004774|Ga0007794_10193434 | Not Available | 606 | Open in IMG/M |
| 3300004807|Ga0007809_10097779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300006071|Ga0007876_1157872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300006072|Ga0007881_1168768 | Not Available | 530 | Open in IMG/M |
| 3300006072|Ga0007881_1172415 | Not Available | 523 | Open in IMG/M |
| 3300006104|Ga0007882_10152959 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006105|Ga0007819_1025971 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300006105|Ga0007819_1106315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300006112|Ga0007857_1017574 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300006114|Ga0007815_1006588 | All Organisms → cellular organisms → Bacteria | 2995 | Open in IMG/M |
| 3300006116|Ga0007807_1062668 | Not Available | 713 | Open in IMG/M |
| 3300006118|Ga0007859_1014412 | Not Available | 1779 | Open in IMG/M |
| 3300006118|Ga0007859_1021412 | Not Available | 1421 | Open in IMG/M |
| 3300006120|Ga0007867_1086473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300006120|Ga0007867_1097171 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009175|Ga0073936_10220265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300009175|Ga0073936_10496596 | Not Available | 718 | Open in IMG/M |
| 3300009502|Ga0114951_10007402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9336 | Open in IMG/M |
| 3300009502|Ga0114951_10374497 | Not Available | 715 | Open in IMG/M |
| 3300009502|Ga0114951_10433250 | Not Available | 651 | Open in IMG/M |
| 3300013093|Ga0164296_1191119 | Not Available | 794 | Open in IMG/M |
| 3300013093|Ga0164296_1236905 | Not Available | 694 | Open in IMG/M |
| 3300013285|Ga0136642_1026836 | Not Available | 1656 | Open in IMG/M |
| 3300013285|Ga0136642_1096423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300020686|Ga0214194_104288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300020686|Ga0214194_112720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300020686|Ga0214194_115992 | Not Available | 644 | Open in IMG/M |
| 3300020716|Ga0214207_1002543 | All Organisms → Viruses → Predicted Viral | 3587 | Open in IMG/M |
| 3300020716|Ga0214207_1004244 | Not Available | 2359 | Open in IMG/M |
| 3300020716|Ga0214207_1030983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300020717|Ga0214248_1024923 | Not Available | 811 | Open in IMG/M |
| 3300020726|Ga0214220_1034012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300020727|Ga0214246_1000157 | Not Available | 19422 | Open in IMG/M |
| 3300020731|Ga0214170_1014780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1437 | Open in IMG/M |
| 3300020731|Ga0214170_1020938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300020731|Ga0214170_1039522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300020733|Ga0214172_1003303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4116 | Open in IMG/M |
| 3300020733|Ga0214172_1004904 | All Organisms → Viruses → Predicted Viral | 3081 | Open in IMG/M |
| 3300020733|Ga0214172_1012387 | Not Available | 1567 | Open in IMG/M |
| 3300021115|Ga0214174_105265 | Not Available | 1123 | Open in IMG/M |
| 3300021121|Ga0214173_101208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3456 | Open in IMG/M |
| 3300021121|Ga0214173_120793 | Not Available | 645 | Open in IMG/M |
| 3300021131|Ga0214206_1000793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8092 | Open in IMG/M |
| 3300021131|Ga0214206_1002882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3435 | Open in IMG/M |
| 3300021131|Ga0214206_1004883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2334 | Open in IMG/M |
| 3300021134|Ga0214171_1042029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C429 | 603 | Open in IMG/M |
| 3300021138|Ga0214164_1066151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300022555|Ga0212088_10012132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13228 | Open in IMG/M |
| 3300022555|Ga0212088_10134418 | Not Available | 2140 | Open in IMG/M |
| 3300025162|Ga0209083_1014862 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
| 3300025316|Ga0209697_10453383 | Not Available | 604 | Open in IMG/M |
| 3300025316|Ga0209697_10472108 | Not Available | 585 | Open in IMG/M |
| 3300025339|Ga0208502_1022125 | Not Available | 542 | Open in IMG/M |
| 3300025358|Ga0208504_1000692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7931 | Open in IMG/M |
| 3300025372|Ga0207957_1037215 | Not Available | 524 | Open in IMG/M |
| 3300025379|Ga0208738_1000811 | Not Available | 7690 | Open in IMG/M |
| 3300025381|Ga0208871_1014851 | Not Available | 1228 | Open in IMG/M |
| 3300025396|Ga0208874_1050350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300025401|Ga0207955_1007534 | Not Available | 2308 | Open in IMG/M |
| 3300025410|Ga0208875_1041738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300025411|Ga0208865_1029668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300025413|Ga0208614_1065859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300025423|Ga0208746_1030435 | Not Available | 917 | Open in IMG/M |
| 3300025723|Ga0208741_10177947 | Not Available | 509 | Open in IMG/M |
| 3300025781|Ga0208386_1007306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1957 | Open in IMG/M |
| 3300025781|Ga0208386_1054887 | Not Available | 532 | Open in IMG/M |
| 3300025782|Ga0208867_1000142 | Not Available | 23381 | Open in IMG/M |
| 3300025783|Ga0208258_1041441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300027896|Ga0209777_10898943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 42.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 22.43% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 14.02% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002301 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI co-culture FSW-F8 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
| 3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020717 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021115 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021134 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025339 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0155492 | 3300000176 | Freshwater | MRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIKWRD* |
| TB18AUG2009E_0076193 | 3300000203 | Freshwater | MKKPWVRPKELTLEDLAWLMFEKTFLEAQEFAYELGYEIVIRWDK* |
| TBL_comb48_EPIDRAFT_100235924 | 3300000439 | Freshwater | MKFKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| TBL_comb48_EPIDRAFT_10343693 | 3300000439 | Freshwater | MRKPWVRPKEITLEDLAWLMFEKTTFLEAQEFAYXLGXEXVIXWXE* |
| JGI24028J26656_10033394 | 3300002091 | Lentic | MKKSKKLKFXELTLEDLAWLMFEKXTFLEAQEFAYELGYEIVIKWRD* |
| JGI24028J26656_10055852 | 3300002091 | Lentic | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVISWKK* |
| JGI24028J26656_10185732 | 3300002091 | Lentic | MKRKPWIKPKELSLEDLAWAMFEKITFLEAQEFAYELGYEIVIRWDK* |
| JGI24218J26658_10060684 | 3300002092 | Lentic | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWKK* |
| JGI24218J26658_10062865 | 3300002092 | Lentic | MKKSKKLKFTELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD* |
| JGI24218J26658_10241402 | 3300002092 | Lentic | KEMTLEHLAWLMFEKVTFLEAQEFAYKLGYEIVIRWKDER* |
| JGI24218J26658_10376292 | 3300002092 | Lentic | TLEHLAWLMFEKVTFLEAQEFAYKLGYEIVIRWKDER* |
| JGI24218J26658_10378711 | 3300002092 | Lentic | MMKKTRIKPKEMTLEHLAWLMFEKVTFLEAQEFAYKLGYEIV |
| JGI24219J26650_10065715 | 3300002098 | Lentic | MKKSKKLKFVELTLEDLAWLMFEKITFLEAQEFAYELGYEIVIKWRD* |
| JGI24219J26650_10301973 | 3300002098 | Lentic | MMKKTRIKPKEMTLEHLAWLMFEKVTFLEAQEFAYKLGYEIVIRWKDER* |
| JGI24219J26650_10414992 | 3300002098 | Lentic | MRKPWVKSKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWNK* |
| JGI24891J29808_10045532 | 3300002301 | Lentic | MRKPWVKPKKLSLEDLAWLMFEKTTFLEAQEFAYELGYEIVISWXK* |
| JGI24891J29808_10174272 | 3300002301 | Lentic | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWIK* |
| JGI24890J29729_10183044 | 3300002307 | Lentic | MRKPWVKSKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVISWNK* |
| JGI24890J29729_10281182 | 3300002307 | Lentic | MVGLMKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| G310J44882_100085251 | 3300002933 | Freshwater | KPWVRPKELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| G310J44882_100248595 | 3300002933 | Freshwater | MKKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007850_100008220 | 3300003783 | Freshwater | MAGLMRKPWVKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007869_10275563 | 3300003809 | Freshwater | VSSVVGLMRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007879_10124752 | 3300003813 | Freshwater | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIR |
| Ga0007856_10038263 | 3300003815 | Freshwater | MKAKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007856_10061422 | 3300003815 | Freshwater | MKRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007856_10085181 | 3300003815 | Freshwater | MRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIR |
| Ga0007875_10144122 | 3300003823 | Freshwater | MRKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0031655_100126051 | 3300003852 | Freshwater Lake Sediment | GKSNCSVSSVVGLMKKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| Ga0031655_103851721 | 3300003852 | Freshwater Lake Sediment | SNCSVSSVVGLMKKPWVKPKELSLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0065173_10732581 | 3300004686 | Freshwater | MKKSKKLKFEELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD* |
| Ga0065171_10332281 | 3300004692 | Freshwater | MRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0065170_10423962 | 3300004694 | Freshwater | MRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007804_10364773 | 3300004770 | Freshwater | MAGLMKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007804_10450383 | 3300004770 | Freshwater | MKRKSWVRPKELTLEELAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007804_10500653 | 3300004770 | Freshwater | MRKPWVRPKEITLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD* |
| Ga0007804_10746062 | 3300004770 | Freshwater | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007804_11854321 | 3300004770 | Freshwater | MKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007794_101934341 | 3300004774 | Freshwater | MKEKSWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007809_100977792 | 3300004807 | Freshwater | MRKPWVRPKELTLEDLAWLMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007876_11578721 | 3300006071 | Freshwater | LTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007881_11687681 | 3300006072 | Freshwater | MKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWK |
| Ga0007881_11724152 | 3300006072 | Freshwater | MKRKPWARPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007882_101529592 | 3300006104 | Freshwater | VVGLMRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007819_10259712 | 3300006105 | Freshwater | VVGLMRKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007819_11063151 | 3300006105 | Freshwater | KPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007857_10175744 | 3300006112 | Freshwater | KPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0007815_10065887 | 3300006114 | Freshwater | MKRKPWARPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRW |
| Ga0007807_10626683 | 3300006116 | Freshwater | MKRKSWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007859_10144122 | 3300006118 | Freshwater | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWNK* |
| Ga0007859_10214122 | 3300006118 | Freshwater | MRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0007867_10864731 | 3300006120 | Freshwater | ELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD* |
| Ga0007867_10971712 | 3300006120 | Freshwater | ITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE* |
| Ga0073936_102202654 | 3300009175 | Freshwater Lake Hypolimnion | GKSHRSVSSVVGLMRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWIK* |
| Ga0073936_104965962 | 3300009175 | Freshwater Lake Hypolimnion | MKKPWIKSKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWIK* |
| Ga0114951_100074022 | 3300009502 | Freshwater | MKRKPWVKPKELSLEDLAWAMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| Ga0114951_103744972 | 3300009502 | Freshwater | MKKPWVKPKELSLEDLAWLMFEKTTLLEAQEFAYELGYEIVIRWNK* |
| Ga0114951_104332502 | 3300009502 | Freshwater | MKKSKKLKVIEFTLEDLAWLMFEKITFLEAQEFAYELGYEIVIRWRE* |
| Ga0164296_11911192 | 3300013093 | Freshwater | MRKPWVRPKELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK* |
| Ga0164296_12369051 | 3300013093 | Freshwater | MKKPWVKPKELSLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK* |
| Ga0136642_10268361 | 3300013285 | Freshwater | MKKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWRD* |
| Ga0136642_10964232 | 3300013285 | Freshwater | MKKTKELTLEDLAWLMFEKTSFLDVQEFAYELGCEIVIRWKE* |
| Ga0214194_1042882 | 3300020686 | Freshwater | MRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214194_1127202 | 3300020686 | Freshwater | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Ga0214194_1159921 | 3300020686 | Freshwater | MKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEI |
| Ga0214207_10025435 | 3300020716 | Freshwater | MRKPWVRPKEITLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD |
| Ga0214207_10042443 | 3300020716 | Freshwater | MKKPWVRPKELTLEDLAWLMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0214207_10309832 | 3300020716 | Freshwater | MKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214248_10249233 | 3300020717 | Freshwater | MKAKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0214220_10340121 | 3300020726 | Freshwater | RSVSSVVGLMKKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Ga0214246_10001577 | 3300020727 | Freshwater | MRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIKWRD |
| Ga0214170_10147801 | 3300020731 | Freshwater | GLMRKPKELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD |
| Ga0214170_10209382 | 3300020731 | Freshwater | VVGLMRKPWVRPKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214170_10395222 | 3300020731 | Freshwater | GLMRKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214172_100330310 | 3300020733 | Freshwater | MKKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Ga0214172_10049049 | 3300020733 | Freshwater | MRKPKELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD |
| Ga0214172_10123873 | 3300020733 | Freshwater | MRKPWVRPKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214174_1052652 | 3300021115 | Freshwater | MRKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214173_1012089 | 3300021121 | Freshwater | MRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWKE |
| Ga0214173_1207931 | 3300021121 | Freshwater | MKKPWVRPKELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIR |
| Ga0214206_100079311 | 3300021131 | Freshwater | MARSKSWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIKWAE |
| Ga0214206_10028829 | 3300021131 | Freshwater | KTMTLEELAYLMFEKVTFLEAQEFAYELGYEIVIRWKE |
| Ga0214206_10048832 | 3300021131 | Freshwater | MKKPKELTLEDLAWIMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0214171_10420292 | 3300021134 | Freshwater | MKKFWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Ga0214164_10661512 | 3300021138 | Freshwater | MAGLMKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0212088_1001213214 | 3300022555 | Freshwater Lake Hypolimnion | MKRKPWIKPKELSLEDLAWAMFEKITFLEAQEFAYELGYEIVIRWDK |
| Ga0212088_101344185 | 3300022555 | Freshwater Lake Hypolimnion | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWNK |
| Ga0209083_10148624 | 3300025162 | Freshwater | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVISWNK |
| Ga0209697_104533831 | 3300025316 | Freshwater Lake Hypolimnion | MRKPWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWIK |
| Ga0209697_104721082 | 3300025316 | Freshwater Lake Hypolimnion | MKKPWIKSKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWIK |
| Ga0208502_10221252 | 3300025339 | Freshwater | MKFKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0208504_10006925 | 3300025358 | Freshwater | MRKPWVKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0207957_10372152 | 3300025372 | Freshwater | MKRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0208738_10008115 | 3300025379 | Freshwater | MKRKPWARPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0208871_10148511 | 3300025381 | Freshwater | MKFKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIR |
| Ga0208874_10503502 | 3300025396 | Freshwater | MKKSKKLKFEELTLEDLAWLMFEKTTFLEAQEFAYELGYEIVIKWRD |
| Ga0207955_10075348 | 3300025401 | Freshwater | SVVGLMRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0208875_10417381 | 3300025410 | Freshwater | LMRKPWVKSKEITLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0208865_10296681 | 3300025411 | Freshwater | KELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0208614_10658593 | 3300025413 | Freshwater | MRKPWVKSKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Ga0208746_10304352 | 3300025423 | Freshwater | MKRKSWVRPKELTLEELAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0208741_101779471 | 3300025723 | Freshwater | MRKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWK |
| Ga0208386_10073066 | 3300025781 | Freshwater | NCSIPSVVGLMRKPWVRPKELTLEDLAWAMFEKVTFLEAQEFAYELGYEIVIRWDK |
| Ga0208386_10548871 | 3300025781 | Freshwater | MAGLMKKPKELTLEDLAWLMFEKTTFLEAQEFAYDLG |
| Ga0208867_100014230 | 3300025782 | Freshwater | MAGLMRKPWVKPKELTLEDLAWLMFEKTTFLEAQEFAYDLGYEIVIRWKE |
| Ga0208258_10414414 | 3300025783 | Freshwater | PWVKPKELSLEDLAWLMFEKTTFLEAQEFAYELGYEIVIRWDK |
| Ga0209777_108989432 | 3300027896 | Freshwater Lake Sediment | MARLMKKPWIKPKELSLEDLAWLMFEKTTFLEAQEFAYELGCEIVIRWNK |
| ⦗Top⦘ |