| Basic Information | |
|---|---|
| Family ID | F091046 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRFLCRVVGHRLPRRRRPFFLTERYQRCERCGERVRLRGR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 65.74 % |
| % of genes near scaffold ends (potentially truncated) | 21.30 % |
| % of genes from short scaffolds (< 2000 bps) | 78.70 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.296 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere (5.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 8.70% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00107 | ADH_zinc_N | 13.89 |
| PF01925 | TauE | 9.26 |
| PF00582 | Usp | 5.56 |
| PF00290 | Trp_syntA | 5.56 |
| PF16884 | ADH_N_2 | 3.70 |
| PF02622 | DUF179 | 3.70 |
| PF01268 | FTHFS | 2.78 |
| PF04185 | Phosphoesterase | 2.78 |
| PF05425 | CopD | 1.85 |
| PF00245 | Alk_phosphatase | 1.85 |
| PF07311 | Dodecin | 1.85 |
| PF12773 | DZR | 1.85 |
| PF02777 | Sod_Fe_C | 1.85 |
| PF01243 | Putative_PNPOx | 1.85 |
| PF13602 | ADH_zinc_N_2 | 1.85 |
| PF04961 | FTCD_C | 1.85 |
| PF00561 | Abhydrolase_1 | 0.93 |
| PF04545 | Sigma70_r4 | 0.93 |
| PF01047 | MarR | 0.93 |
| PF12903 | DUF3830 | 0.93 |
| PF13683 | rve_3 | 0.93 |
| PF02811 | PHP | 0.93 |
| PF01381 | HTH_3 | 0.93 |
| PF00672 | HAMP | 0.93 |
| PF02073 | Peptidase_M29 | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF04542 | Sigma70_r2 | 0.93 |
| PF12802 | MarR_2 | 0.93 |
| PF00140 | Sigma70_r1_2 | 0.93 |
| PF02729 | OTCace_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 9.26 |
| COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 5.56 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 3.70 |
| COG2759 | Formyltetrahydrofolate synthetase | Nucleotide transport and metabolism [F] | 2.78 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 2.78 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.85 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.85 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 1.85 |
| COG1785 | Alkaline phosphatase | Inorganic ion transport and metabolism [P] | 1.85 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.85 |
| COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 1.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.93 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.93 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.93 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.30 % |
| Unclassified | root | N/A | 28.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001380|JGI1356J14229_10007227 | All Organisms → cellular organisms → Bacteria | 7884 | Open in IMG/M |
| 3300003267|soilL1_10035606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2611 | Open in IMG/M |
| 3300003267|soilL1_10074844 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300003324|soilH2_10169021 | Not Available | 2084 | Open in IMG/M |
| 3300004114|Ga0062593_100182872 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300004156|Ga0062589_102202003 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300004157|Ga0062590_100237082 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300004157|Ga0062590_101634422 | Not Available | 653 | Open in IMG/M |
| 3300004479|Ga0062595_100653401 | Not Available | 833 | Open in IMG/M |
| 3300004480|Ga0062592_101152745 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005186|Ga0066676_10994637 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005187|Ga0066675_10207186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1381 | Open in IMG/M |
| 3300005218|Ga0068996_10168530 | Not Available | 549 | Open in IMG/M |
| 3300005332|Ga0066388_108247398 | Not Available | 520 | Open in IMG/M |
| 3300005336|Ga0070680_100119091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2203 | Open in IMG/M |
| 3300005337|Ga0070682_101923757 | Not Available | 519 | Open in IMG/M |
| 3300005445|Ga0070708_101862401 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005529|Ga0070741_10054504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4772 | Open in IMG/M |
| 3300005529|Ga0070741_10538654 | Not Available | 1051 | Open in IMG/M |
| 3300005555|Ga0066692_10312005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300005598|Ga0066706_11279564 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005937|Ga0081455_10088040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2525 | Open in IMG/M |
| 3300006865|Ga0073934_10200688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1357 | Open in IMG/M |
| 3300006876|Ga0079217_11743146 | Not Available | 503 | Open in IMG/M |
| 3300006903|Ga0075426_11286918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 555 | Open in IMG/M |
| 3300006914|Ga0075436_100791282 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006914|Ga0075436_100799882 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009137|Ga0066709_100119581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3287 | Open in IMG/M |
| 3300009137|Ga0066709_104614898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300009162|Ga0075423_10177650 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300009617|Ga0116123_1124725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 674 | Open in IMG/M |
| 3300009809|Ga0105089_1035055 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300009837|Ga0105058_1091395 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300009840|Ga0126313_10856869 | Not Available | 741 | Open in IMG/M |
| 3300010304|Ga0134088_10333864 | Not Available | 735 | Open in IMG/M |
| 3300010362|Ga0126377_10349585 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300011270|Ga0137391_10438686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300012202|Ga0137363_11429832 | Not Available | 582 | Open in IMG/M |
| 3300012211|Ga0137377_10646509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300012363|Ga0137390_10092364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2986 | Open in IMG/M |
| 3300012960|Ga0164301_11751190 | Not Available | 521 | Open in IMG/M |
| 3300012971|Ga0126369_10509273 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300012971|Ga0126369_11496196 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300014269|Ga0075302_1162973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300014502|Ga0182021_12657298 | Not Available | 602 | Open in IMG/M |
| 3300015245|Ga0137409_11326246 | Not Available | 563 | Open in IMG/M |
| 3300015371|Ga0132258_10254822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4292 | Open in IMG/M |
| 3300015371|Ga0132258_10861452 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300015371|Ga0132258_11737108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1573 | Open in IMG/M |
| 3300015371|Ga0132258_12722039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1233 | Open in IMG/M |
| 3300015372|Ga0132256_101173513 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300015372|Ga0132256_102261297 | Not Available | 648 | Open in IMG/M |
| 3300015374|Ga0132255_100156617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3181 | Open in IMG/M |
| 3300015374|Ga0132255_102749604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300018032|Ga0187788_10120526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 965 | Open in IMG/M |
| 3300018032|Ga0187788_10463323 | Not Available | 542 | Open in IMG/M |
| 3300018060|Ga0187765_10184815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1196 | Open in IMG/M |
| 3300018060|Ga0187765_10467407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300018060|Ga0187765_11007298 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300018064|Ga0187773_10761026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 611 | Open in IMG/M |
| 3300018422|Ga0190265_13841568 | Not Available | 501 | Open in IMG/M |
| 3300018433|Ga0066667_10856593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 778 | Open in IMG/M |
| 3300018433|Ga0066667_11595635 | Not Available | 581 | Open in IMG/M |
| 3300019356|Ga0173481_10133294 | Not Available | 1003 | Open in IMG/M |
| 3300022883|Ga0247786_1076853 | Not Available | 702 | Open in IMG/M |
| 3300024288|Ga0179589_10371384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300025164|Ga0209521_10251465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300025167|Ga0209642_10149070 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300025174|Ga0209324_10616063 | Not Available | 636 | Open in IMG/M |
| 3300025310|Ga0209172_10140693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| 3300025314|Ga0209323_10070302 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
| 3300025318|Ga0209519_10759846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300025324|Ga0209640_10586338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
| 3300025325|Ga0209341_10458151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
| 3300025326|Ga0209342_10438885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300025326|Ga0209342_10652057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300025327|Ga0209751_10500675 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300025919|Ga0207657_10753505 | Not Available | 754 | Open in IMG/M |
| 3300025945|Ga0207679_10921685 | Not Available | 799 | Open in IMG/M |
| 3300025985|Ga0210117_1088848 | Not Available | 549 | Open in IMG/M |
| 3300026528|Ga0209378_1281567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300027169|Ga0209897_1073311 | Not Available | 509 | Open in IMG/M |
| 3300027819|Ga0209514_10003809 | All Organisms → cellular organisms → Bacteria | 21026 | Open in IMG/M |
| 3300027819|Ga0209514_10022183 | All Organisms → cellular organisms → Bacteria | 5559 | Open in IMG/M |
| 3300028556|Ga0265337_1137073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 663 | Open in IMG/M |
| 3300028558|Ga0265326_10242623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300028589|Ga0247818_10523160 | Not Available | 810 | Open in IMG/M |
| 3300028589|Ga0247818_11079153 | Not Available | 570 | Open in IMG/M |
| 3300028654|Ga0265322_10185466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 595 | Open in IMG/M |
| 3300028666|Ga0265336_10042849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1381 | Open in IMG/M |
| 3300028800|Ga0265338_10054242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3577 | Open in IMG/M |
| 3300028800|Ga0265338_10111928 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300028812|Ga0247825_10091086 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300031170|Ga0307498_10030618 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300031726|Ga0302321_103130854 | Not Available | 539 | Open in IMG/M |
| 3300031799|Ga0318565_10398117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300031995|Ga0307409_102811265 | Not Available | 514 | Open in IMG/M |
| 3300032002|Ga0307416_102588878 | Not Available | 605 | Open in IMG/M |
| 3300032075|Ga0310890_11467783 | Not Available | 561 | Open in IMG/M |
| 3300032163|Ga0315281_10021665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 8405 | Open in IMG/M |
| 3300032180|Ga0307471_102452133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300032829|Ga0335070_10008993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11730 | Open in IMG/M |
| 3300032829|Ga0335070_10046127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4828 | Open in IMG/M |
| 3300032892|Ga0335081_10723232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1203 | Open in IMG/M |
| 3300032893|Ga0335069_10022681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8643 | Open in IMG/M |
| 3300033158|Ga0335077_11261247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300033233|Ga0334722_10111689 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300033551|Ga0247830_10742316 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 5.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.78% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.85% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1356J14229_1000722713 | 3300001380 | Groundwater | MLHLSRSLVCRIVGHRLPRSKRPFFLTERFQRCERCGERVRAKYR* |
| soilL1_100356064 | 3300003267 | Sugarcane Root And Bulk Soil | MRRVICRALGHKLPRRRRPFFLTERYQRCERCGERVRLEDR* |
| soilL1_100748443 | 3300003267 | Sugarcane Root And Bulk Soil | VNILCRVFGHRLPRRRRPFFLTDHFQRCERCGERVRLKDR* |
| soilH2_101690212 | 3300003324 | Sugarcane Root And Bulk Soil | MRRVICRALGHRLPRRRRPFFLTERYQRCERCGERVRLEDR* |
| Ga0062593_1001828723 | 3300004114 | Soil | VNLRCRIFGHRLPRRKRPFFLTDRFQRCERCGERVALKGR* |
| Ga0062589_1022020032 | 3300004156 | Soil | VTPLRCRLFGHRLPRRKRPFFLIDRFQRCERCGARVPLKDRERP* |
| Ga0062590_1002370822 | 3300004157 | Soil | VSLRCRIFGHRLPRRKRPFFLTDRFQRCERCGERVALKGR* |
| Ga0062590_1016344222 | 3300004157 | Soil | VNWICRVFGHRLPRRRRPFFLTDLFQKCERCGERVRLKDR* |
| Ga0062595_1006534011 | 3300004479 | Soil | MKRAVCRVIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0062592_1011527453 | 3300004480 | Soil | VTPLRCRLFGHRLPRRKRPFFLIDRFQRCERCGARVPLKDRDRP* |
| Ga0066676_109946371 | 3300005186 | Soil | VKLRCRLLGHKLPRRKRPFFLTDRFQRCERCGERVLLKDR* |
| Ga0066675_102071863 | 3300005187 | Soil | MRRHLCRVLGHKLPRRRRPFFLTERFQRCERCGERVMLKGRE* |
| Ga0068996_101685302 | 3300005218 | Natural And Restored Wetlands | PYPGYRVGSHMKRALCSVIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0066388_1082473982 | 3300005332 | Tropical Forest Soil | MRGTFCRVLGHRLPRRKRPFFLIERYQRCERCGARVRLKDR* |
| Ga0070680_1001190913 | 3300005336 | Corn Rhizosphere | MRRLTCRVLGHKLPRRRRPFFLTERFQRCERCGKRIPLKGR* |
| Ga0070682_1019237572 | 3300005337 | Corn Rhizosphere | MRRLTCRFLGHKLPRRRRPFFLTERFQRCERCGARVRLRGR* |
| Ga0070708_1018624012 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRAVCRLIGHKLPRRKRPFFLIERYQRCERCGERVRLRGR* |
| Ga0070741_100545044 | 3300005529 | Surface Soil | MRNVICRVLGHKLPRRKRPFFLIERYQRCERCGERVRLRDR* |
| Ga0070741_105386542 | 3300005529 | Surface Soil | MRNLICRVLGHKLPRRKRPFFLIERYQRCERCGERVRLRDR* |
| Ga0066692_103120052 | 3300005555 | Soil | MRRELLCRLVGHKLPRRRRPFFFPERFQRCERCGERVKVRGL* |
| Ga0066706_112795642 | 3300005598 | Soil | VRRILCTVIGHRLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0081455_100880402 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VTLRCRVLGHRLPRRKRPFFLTDRFQRCERCGDRVLLKNR* |
| Ga0073934_102006883 | 3300006865 | Hot Spring Sediment | VKLRCRLLGHRLPRRKRPFFLTERFQRCERCGRRIRLRDR* |
| Ga0079217_117431462 | 3300006876 | Agricultural Soil | MLRCRLFGHRLPRRRRPFFLTERYQRCERCGKRVLLRGR* |
| Ga0075426_112869182 | 3300006903 | Populus Rhizosphere | MRRAVCRLIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0075436_1007912822 | 3300006914 | Populus Rhizosphere | MRRTLCRLIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0075436_1007998822 | 3300006914 | Populus Rhizosphere | VCRLIGHKLPRRKRPFFLIERYQRCERCGERVRLRGR* |
| Ga0066709_1001195815 | 3300009137 | Grasslands Soil | MRRALCRVIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0066709_1046148982 | 3300009137 | Grasslands Soil | MRRILCSVVGHRLPRRKRPFFLIERYQRCERCGERVRLKDR* |
| Ga0075423_101776502 | 3300009162 | Populus Rhizosphere | MKRALCRVIGHKLPRRKRPFFLIERYQRCERCGERVRLKDR* |
| Ga0116123_11247251 | 3300009617 | Peatland | DDRLAAGRNGMARFICRIVGHRLPRRRRPFFLTERYQRCERCGERVRLRGR* |
| Ga0105089_10350551 | 3300009809 | Groundwater Sand | MCRLFGHRLPRRKRPFFVLEPPLQRCERCGKRALVKIRR* |
| Ga0105058_10913952 | 3300009837 | Groundwater Sand | MNLLCRLLGHRLPRRKRPFFLTERFQRCERCGKRVRLKDR* |
| Ga0126313_108568693 | 3300009840 | Serpentine Soil | LCRLVGHRLPRRKRPFFLLEPPLQRCERCGKRVLVRIGR* |
| Ga0134088_103338642 | 3300010304 | Grasslands Soil | MRRALCRVIGHKLPRRKRPFFLIERYQRCQRCGERVRLKGR* |
| Ga0126377_103495852 | 3300010362 | Tropical Forest Soil | VLGHRLPRRKRPFFLIERYQRCERCGARVRLKDR* |
| Ga0137391_104386861 | 3300011270 | Vadose Zone Soil | AGMRRELLCRLVGHKLPRRRRPFFFPERFQRCERCGERVKVRGL* |
| Ga0137363_114298322 | 3300012202 | Vadose Zone Soil | MRRLTCRILGHKLPRRRRPFFLTERFQRCERCGKRVALKGR* |
| Ga0137377_106465093 | 3300012211 | Vadose Zone Soil | MRRELLCRLVGHKLPRRRRPFFFPERFQRCERCGERVKLRGQRW* |
| Ga0137390_100923643 | 3300012363 | Vadose Zone Soil | MRRELLCRLVGHKLPRRRRPFFFPERFQRCERCGERVKVR |
| Ga0164301_117511902 | 3300012960 | Soil | MRRLTCRFLGHKLPRRRRPFFLTERFQRCERCGKRIPLKGR* |
| Ga0126369_105092732 | 3300012971 | Tropical Forest Soil | MRRILCSMVGHRLPRRKRPFFLIERYQRCERCGERVRLKGR* |
| Ga0126369_114961962 | 3300012971 | Tropical Forest Soil | MRRILCSVVGHRLPRRKRPFFLIDRYQRCERCGERVRLKGR* |
| Ga0075302_11629732 | 3300014269 | Natural And Restored Wetlands | MTLRCRVFGHKLLRRKRPFFLTERYQRCDRCGKRIRLKGR* |
| Ga0182021_126572982 | 3300014502 | Fen | MKRVLCRVVGHRLPRRKRPFFLTDRYQRCERCGKRVRLKDR* |
| Ga0137409_113262462 | 3300015245 | Vadose Zone Soil | MLCNVLGHKLPRRKRPFFLIERYQPCSRCGERVRLKGR* |
| Ga0132258_102548223 | 3300015371 | Arabidopsis Rhizosphere | VNWMCRVLGHRLPRRRRPFFLTDLFQKCERCGERVRLKDR* |
| Ga0132258_108614524 | 3300015371 | Arabidopsis Rhizosphere | MTLRCRLLGHKLPRRKRPFFLTDRFQRCERCGQRVLLKDR* |
| Ga0132258_117371082 | 3300015371 | Arabidopsis Rhizosphere | VKRALCHVLGHRLPRRKRPFFLIERYQRCERCGERVRLKDR* |
| Ga0132258_127220392 | 3300015371 | Arabidopsis Rhizosphere | MNWLCRVFGHRLPKRRRPFFLTDLFQKCERCGERVRLKDR* |
| Ga0132256_1011735132 | 3300015372 | Arabidopsis Rhizosphere | RGSLCRVLGHRLPRRKRPFFLIESYQRCERCGARVRLKDR* |
| Ga0132256_1022612971 | 3300015372 | Arabidopsis Rhizosphere | VTPLRCRLFGHRLPRRKRPFFLIDRFQRCERCGERVPLKDRDRS* |
| Ga0132255_1001566174 | 3300015374 | Arabidopsis Rhizosphere | VNWLCRVFGHRLPRRRRPFFLTDHFQKCERCGERVRLKDR* |
| Ga0132255_1027496041 | 3300015374 | Arabidopsis Rhizosphere | AGRVRGSLCRVLGHRLPRRKRPFFLIERYQRCERCGARVRLKDR* |
| Ga0187788_101205262 | 3300018032 | Tropical Peatland | MRRFLCRVVGHRLPRRRRPFFLTERYQRCERCGERVRLRGR |
| Ga0187788_104633231 | 3300018032 | Tropical Peatland | MRRRFLCRVVGHRLPRRRRPFFLTERYQRCERCGERVRLRGR |
| Ga0187765_101848152 | 3300018060 | Tropical Peatland | VKRLLCSVIGHKLPRRKRPFFLIERYQRCDRCGERVRLKGR |
| Ga0187765_104674072 | 3300018060 | Tropical Peatland | VKRVLCNVIGHKLPRRKRPFFLIERYQRCDRCGERIRLKGR |
| Ga0187765_110072981 | 3300018060 | Tropical Peatland | MRRILCNVVGHRLPRRKRPFFLIERYQRCERCGERVR |
| Ga0187773_107610261 | 3300018064 | Tropical Peatland | AAVRRVLCRLVGHRLPRRHRPFFLTERYQRCERCGERVRLRGR |
| Ga0190265_138415682 | 3300018422 | Soil | VVRCRIFGHRLPRRRRPFFLTERFQRCERCGRRIRLKGR |
| Ga0066667_108565932 | 3300018433 | Grasslands Soil | VKLRCRLLGHKLPRRKRPFFLTDRFQRCERCGERVLLKDR |
| Ga0066667_115956352 | 3300018433 | Grasslands Soil | MRRALCRVIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR |
| Ga0173481_101332941 | 3300019356 | Soil | VSLRCRIFGHRLPRRKRPFFLTDRFQRCERCGERVALKGR |
| Ga0247786_10768532 | 3300022883 | Soil | VNWICRVFGHRLPRRRRPFFLTDLFQKCERCGERVRLKD |
| Ga0179589_103713842 | 3300024288 | Vadose Zone Soil | MRRLTCRILGHKLPRRRRPFFLTERFQRCERCGKRVALKGR |
| Ga0209521_102514652 | 3300025164 | Soil | MIRLSRALLCRVLGHRLPRSKRPFFLTERFQRCDRCGERVRAKYR |
| Ga0209642_101490703 | 3300025167 | Soil | MVRLSRSLLCRVLGHRLPRSKRPFFLTERFQRCERCGERVRAKYR |
| Ga0209324_106160631 | 3300025174 | Soil | VAGYSPRMIRLSRALLCRVLGHRLPRSKRPFFLTERFQRCDRCGERVRAKYR |
| Ga0209172_101406933 | 3300025310 | Hot Spring Sediment | VKLRCRLLGHRLPRRKRPFFLTERFQRCERCGKRIRLHDR |
| Ga0209323_100703023 | 3300025314 | Soil | SPRMVRLSRSLLCRVLGHRLPRSKRPFFLTERFQRCDRCGERVRAKYR |
| Ga0209519_107598461 | 3300025318 | Soil | MIRLSRSLLCRVLGHRLPRSKRPFFLTERFQRCERCGERVRAKYR |
| Ga0209640_105863382 | 3300025324 | Soil | MIRLSRSLLCRVLGHRLPRSKRSFFLTERFQRCERCGERVRAKYR |
| Ga0209341_104581511 | 3300025325 | Soil | VIRLSRSLLCRVLGHRLPRSKRPFFLTERFQRCERCGERVRAKHR |
| Ga0209342_104388853 | 3300025326 | Soil | MIRLSRSFLCRVLGHRLPRSKRPFFLTERFQRCERCGERVRAKHR |
| Ga0209342_106520571 | 3300025326 | Soil | RVLGHGLPRSKRPFFLTERFQRCERCGERVRAKHR |
| Ga0209751_105006751 | 3300025327 | Soil | VSAAAGYSARMIRLSRSLLCRVLGHRLPRSKRPFFLTERFQRCERCGERVRAKYR |
| Ga0207657_107535052 | 3300025919 | Corn Rhizosphere | MNWLCRVFGHRLPKRRRPFFLTDLFQKCERCGERVRLKDR |
| Ga0207679_109216852 | 3300025945 | Corn Rhizosphere | VTPLRCRLFGHRLPRRKRPFFLIDRFQRCERCGARVPLKDRDRP |
| Ga0210117_10888482 | 3300025985 | Natural And Restored Wetlands | PYPGYRVGSHMKRALCSVIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR |
| Ga0209378_12815671 | 3300026528 | Soil | MRRELLCRLVGHKLPRRRRPFFFPERFQRCERCGERVKVRGL |
| Ga0209897_10733111 | 3300027169 | Groundwater Sand | MCRLFGHRLPRRKRPFFVLEPPLQRCERCGKRVLVKIRR |
| Ga0209514_1000380918 | 3300027819 | Groundwater | MLHLSRSLVCRIVGHRLPRSKRPFFLTERFQRCERCGERVRAKYR |
| Ga0209514_100221831 | 3300027819 | Groundwater | VAGYSPRMLRLSLSLVCRVFGHRLPRSKRPFFLTERFQRCERCGERVRAKYR |
| Ga0265337_11370732 | 3300028556 | Rhizosphere | MPKLLCRVLGHRLPRRRRPFFLTERYQRCERCGERVRLRGR |
| Ga0265326_102426232 | 3300028558 | Rhizosphere | MARFLCRILGHRLPRRRRPFFLTERYQRCERCGERVRLRGR |
| Ga0247818_105231602 | 3300028589 | Soil | VKLRCRVLGHRLPRRKRPFFLTERFQRCERCGERIRLKDR |
| Ga0247818_110791531 | 3300028589 | Soil | VNWLCRVLGHRLPRRRRPFFLTDLFQRCERCGERVRLKDR |
| Ga0265322_101854661 | 3300028654 | Rhizosphere | GDDMRFLCRILGHRLPRRRRPFFLTERYQRCERCGERIRLRGR |
| Ga0265336_100428492 | 3300028666 | Rhizosphere | MRFLCRILGHRLPRRRRPFFLTERYQRCERCGERIRLRGR |
| Ga0265338_100542425 | 3300028800 | Rhizosphere | MPKLLCRVLGHRLPRRRRPFFLTERYQRCDRCGERVRLRGR |
| Ga0265338_101119284 | 3300028800 | Rhizosphere | MARFLCRIFGHRLPRRRRPFFLTERYQRCERCGERVRLRDR |
| Ga0247825_100910865 | 3300028812 | Soil | MKLRCRLLGHRLPRRKRPFFLTELFQRCERCGERIRLKDR |
| Ga0307498_100306182 | 3300031170 | Soil | VKLRCRILGHRLPRRRRPFFLTERYQRCERCGKRVRLRDR |
| Ga0302321_1031308542 | 3300031726 | Fen | MKRVLCRVVGHRLPRRKRPFFLTDRYQRCERCGKRVRLKDR |
| Ga0318565_103981171 | 3300031799 | Soil | SSVLCRVVGHRLPRRKRPFFITEHFQRCERCGERVLIRDR |
| Ga0307409_1028112651 | 3300031995 | Rhizosphere | VNWICRVVGHRLPRRRRPFFLTDLFQRCERCGERVR |
| Ga0307416_1025888781 | 3300032002 | Rhizosphere | VNWICRVVGHRLPRRRRPFFLTDLFQRCERCGERVRLKDR |
| Ga0310890_114677832 | 3300032075 | Soil | VNWLCRVLGHRLPRRRRPFFLTDPFQKCERCGERVRLKD |
| Ga0315281_100216659 | 3300032163 | Sediment | MALLRRSLLCRVFGHRLPRRKRPFFLTERFQRCERCGERVTAKYL |
| Ga0307471_1024521332 | 3300032180 | Hardwood Forest Soil | MRRAVCRLIGHKLPRRKRPFFLIERYQRCERCGERVRLKGR |
| Ga0335070_100089934 | 3300032829 | Soil | VPRFLCRVLGHRLPRRRRPFFLTERYQRCERCGERVRLRDR |
| Ga0335070_100461272 | 3300032829 | Soil | MRRVMCRIVGHRLPRRRRPFFLTERYQRCERCGARVRLRGR |
| Ga0335081_107232322 | 3300032892 | Soil | MARLLCRILGHRLPRRRRPFFLTERYQRCERCGERVRLRDR |
| Ga0335069_1002268110 | 3300032893 | Soil | MRRVLCRIVGHRLPRRHRPFFLTERYQRCERCGARIRLRGR |
| Ga0335077_112612472 | 3300033158 | Soil | VRRHLCRVIGHRLPRRRRPFFLTERYQRCERCGERVRL |
| Ga0334722_101116891 | 3300033233 | Sediment | VNGPAKRFLCTVLGHKLPRRKRPFFLIERHQRCERCGERVRLKGR |
| Ga0247830_107423163 | 3300033551 | Soil | VRKKGRVLGHRLPRRKRPFFLTERFQRCERCGERIRLKDR |
| ⦗Top⦘ |