| Basic Information | |
|---|---|
| Family ID | F091039 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MKTRGIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.56 % |
| % of genes near scaffold ends (potentially truncated) | 33.33 % |
| % of genes from short scaffolds (< 2000 bps) | 76.85 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.593 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.444 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF01548 | DEDD_Tnp_IS110 | 33.33 |
| PF02371 | Transposase_20 | 25.00 |
| PF00122 | E1-E2_ATPase | 1.85 |
| PF01734 | Patatin | 1.85 |
| PF00078 | RVT_1 | 1.85 |
| PF09450 | DUF2019 | 1.85 |
| PF11578 | DUF3237 | 1.85 |
| PF13598 | DUF4139 | 1.85 |
| PF14014 | DUF4230 | 0.93 |
| PF05973 | Gp49 | 0.93 |
| PF12697 | Abhydrolase_6 | 0.93 |
| PF14686 | fn3_3 | 0.93 |
| PF07676 | PD40 | 0.93 |
| PF08031 | BBE | 0.93 |
| PF13377 | Peripla_BP_3 | 0.93 |
| PF08388 | GIIM | 0.93 |
| PF03050 | DDE_Tnp_IS66 | 0.93 |
| PF13561 | adh_short_C2 | 0.93 |
| PF00873 | ACR_tran | 0.93 |
| PF00550 | PP-binding | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 58.33 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.85 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.85 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 1.85 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.85 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.85 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.85 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.93 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.93 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.59 % |
| Unclassified | root | N/A | 7.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10031407 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
| 3300001154|JGI12636J13339_1004332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2336 | Open in IMG/M |
| 3300001356|JGI12269J14319_10257904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300001404|JGI20181J14860_1005312 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300001661|JGI12053J15887_10035541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2803 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100083454 | All Organisms → cellular organisms → Bacteria | 2970 | Open in IMG/M |
| 3300002562|JGI25382J37095_10278841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300003369|JGI24140J50213_10016054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2830 | Open in IMG/M |
| 3300005167|Ga0066672_10170847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300005171|Ga0066677_10229917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300005434|Ga0070709_10299003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300005435|Ga0070714_100465895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300005436|Ga0070713_100406043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300005447|Ga0066689_10105928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300005467|Ga0070706_100142582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2236 | Open in IMG/M |
| 3300005471|Ga0070698_100005907 | All Organisms → cellular organisms → Bacteria | 13353 | Open in IMG/M |
| 3300005542|Ga0070732_10980943 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005557|Ga0066704_10061676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2393 | Open in IMG/M |
| 3300005568|Ga0066703_10120820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
| 3300005598|Ga0066706_11353922 | Not Available | 537 | Open in IMG/M |
| 3300005921|Ga0070766_10452813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300006032|Ga0066696_10397663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300006050|Ga0075028_100473061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300006052|Ga0075029_100083140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
| 3300006057|Ga0075026_100947665 | Not Available | 532 | Open in IMG/M |
| 3300006640|Ga0075527_10034360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300006642|Ga0075521_10094551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300006642|Ga0075521_10113733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1250 | Open in IMG/M |
| 3300006796|Ga0066665_10032673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3434 | Open in IMG/M |
| 3300006796|Ga0066665_10206948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1527 | Open in IMG/M |
| 3300006854|Ga0075425_101527620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300007258|Ga0099793_10112180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300009089|Ga0099828_10932641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300009090|Ga0099827_10251040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| 3300009137|Ga0066709_100135135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3118 | Open in IMG/M |
| 3300009523|Ga0116221_1159119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300009640|Ga0116126_1074198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300009700|Ga0116217_10042650 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300010336|Ga0134071_10247578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300011270|Ga0137391_10208918 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300011271|Ga0137393_10032360 | All Organisms → cellular organisms → Bacteria | 3968 | Open in IMG/M |
| 3300012096|Ga0137389_11505858 | Not Available | 569 | Open in IMG/M |
| 3300012189|Ga0137388_10794097 | Not Available | 877 | Open in IMG/M |
| 3300012201|Ga0137365_10233837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1369 | Open in IMG/M |
| 3300012203|Ga0137399_10181611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1699 | Open in IMG/M |
| 3300012205|Ga0137362_10043128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3644 | Open in IMG/M |
| 3300012207|Ga0137381_10142586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2057 | Open in IMG/M |
| 3300012349|Ga0137387_10265949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300012356|Ga0137371_11116797 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012359|Ga0137385_10366284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300012361|Ga0137360_10768738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300012927|Ga0137416_10028317 | All Organisms → cellular organisms → Bacteria | 3697 | Open in IMG/M |
| 3300012944|Ga0137410_10742472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 820 | Open in IMG/M |
| 3300015193|Ga0167668_1001591 | All Organisms → cellular organisms → Bacteria | 4729 | Open in IMG/M |
| 3300017822|Ga0187802_10040581 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300017822|Ga0187802_10182723 | Not Available | 805 | Open in IMG/M |
| 3300017995|Ga0187816_10443047 | Not Available | 581 | Open in IMG/M |
| 3300018017|Ga0187872_10046685 | All Organisms → cellular organisms → Bacteria | 2336 | Open in IMG/M |
| 3300018062|Ga0187784_10818120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300018468|Ga0066662_10180443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300019887|Ga0193729_1202519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300021168|Ga0210406_11070072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021403|Ga0210397_10573734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300021405|Ga0210387_10075161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2774 | Open in IMG/M |
| 3300025457|Ga0208850_1004322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3117 | Open in IMG/M |
| 3300025464|Ga0208076_1054894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300025474|Ga0208479_1049249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300025527|Ga0208714_1026831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300025581|Ga0208355_1061353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300025878|Ga0209584_10044986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1555 | Open in IMG/M |
| 3300025878|Ga0209584_10077555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300025910|Ga0207684_10167153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1896 | Open in IMG/M |
| 3300025928|Ga0207700_11206125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300026309|Ga0209055_1065285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1530 | Open in IMG/M |
| 3300026313|Ga0209761_1174434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300026317|Ga0209154_1063212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1625 | Open in IMG/M |
| 3300026354|Ga0257180_1001965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1868 | Open in IMG/M |
| 3300026358|Ga0257166_1014759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300026446|Ga0257178_1000811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2288 | Open in IMG/M |
| 3300026469|Ga0257169_1003399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1635 | Open in IMG/M |
| 3300026480|Ga0257177_1002055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2109 | Open in IMG/M |
| 3300026482|Ga0257172_1035871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300026498|Ga0257156_1008169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1968 | Open in IMG/M |
| 3300026528|Ga0209378_1025588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3195 | Open in IMG/M |
| 3300026538|Ga0209056_10191835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1506 | Open in IMG/M |
| 3300026557|Ga0179587_10216237 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300027109|Ga0208603_1025400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300027546|Ga0208984_1016887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
| 3300027548|Ga0209523_1114714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027565|Ga0209219_1072748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300027667|Ga0209009_1025511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
| 3300027854|Ga0209517_10188891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300027882|Ga0209590_10260056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300027903|Ga0209488_10184073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
| 3300027905|Ga0209415_10230872 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300027915|Ga0209069_10755603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300028536|Ga0137415_10037115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4781 | Open in IMG/M |
| 3300028906|Ga0308309_11109281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300030706|Ga0310039_10208534 | Not Available | 767 | Open in IMG/M |
| 3300030707|Ga0310038_10108653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300030862|Ga0265753_1074326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300031090|Ga0265760_10375807 | Not Available | 511 | Open in IMG/M |
| 3300031754|Ga0307475_10345044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300031820|Ga0307473_10241069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300031962|Ga0307479_10025550 | All Organisms → cellular organisms → Bacteria | 5600 | Open in IMG/M |
| 3300032174|Ga0307470_10090002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1724 | Open in IMG/M |
| 3300033433|Ga0326726_10025682 | All Organisms → cellular organisms → Bacteria | 5122 | Open in IMG/M |
| 3300034125|Ga0370484_0014476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1737 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.26% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001404 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100314073 | 3300000567 | Peatlands Soil | MKTRGIVLQGLDSGKDRDAEPGTPLRLSVFEPMVDSRSITEGKDVAGMAE* |
| JGI12636J13339_10043321 | 3300001154 | Forest Soil | MGMFERRDNFDDRASRSPLVMKTRGLVLQGLDFGKGNAKHGAPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| JGI12269J14319_102579041 | 3300001356 | Peatlands Soil | VLQGLDFGKDRDGEHSTPLRLSMVDSMVDSRSITEGKDVAGMAE* |
| JGI20181J14860_10053121 | 3300001404 | Arctic Peat Soil | KTRSIVLQGLDFGKDRDSGHGTPRRLSRFDPIVDSRSITEGKDVAGMAE* |
| JGI12053J15887_100355414 | 3300001661 | Forest Soil | MKTRGIVLQGLDFGKGRDAEHGTPLRLSMFDPMVDSGSITEGKDVAGMAE* |
| JGIcombinedJ26739_1000834542 | 3300002245 | Forest Soil | MKTRGIVLQGLDLGKNRDAEXGXPLRLSMFDPMVDSXSITEGKDVAGMAE* |
| JGI25382J37095_102788411 | 3300002562 | Grasslands Soil | MKTRGIVLQGLDFGKIRDAEHNTPPPVVDVRPMIHSCSITEDKDVAGMAE* |
| JGI24140J50213_100160542 | 3300003369 | Arctic Peat Soil | MKTRGIVLQGLDFGKDRDFGRGTPLRLSMFDLMVDSRSITEGKDVAGMAE* |
| Ga0066672_101708472 | 3300005167 | Soil | MKTRGIVLQGLDFGKGRDAEHGAPLRLSMFDPVVDSRSITEGKDVAGMAE* |
| Ga0066677_102299171 | 3300005171 | Soil | MKTRGIVLQGLDFGKGRAAEPGTPLRLSMFEPMVDSRSITEGKDVAGMAE* |
| Ga0070709_102990032 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRGVVLQGLDFSKGRAADHGTSLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0070714_1004658952 | 3300005435 | Agricultural Soil | MKTRGIVLQGLDFGKDRMPSTSLDLRLSMVDPMVDSRSITEGKDVAGMAE* |
| Ga0070713_1004060432 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRGIVLQGPDFGKDRDSGHGTPLRLSMSDPMVDSRSITEGKDVAGMAE* |
| Ga0066689_101059281 | 3300005447 | Soil | LQRLDFGKGRAAEHGTPLRLSMFDLMVDSRSITEGKDVAGMAE* |
| Ga0070706_1001425822 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRGIVLRGLDFGKDRDAVHGTPQRLSMFNPMVDSRSITEGKDVAGMAE* |
| Ga0070698_10000590712 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRGIVLRGLDFGKDRAAVHGTPQRLSMFNPMVDSRSITEGKDVAGMAE* |
| Ga0070732_109809432 | 3300005542 | Surface Soil | MKTRGIVLQGLDFGKGRDAAHITPLRLSMVDPMVDSRSITEGKDVAGMAE* |
| Ga0066704_100616763 | 3300005557 | Soil | MKTRGIVLQGLDFGKGRDAEHGAPVRLSMFDPVVDSRSITEGKDVAGMAE* |
| Ga0066703_101208202 | 3300005568 | Soil | LQGLDFGKGRDAEHGAPLRLSMFDPVVDSRSITEGKDVAGMAE* |
| Ga0066706_113539221 | 3300005598 | Soil | LQGLDFGKDRDAEPGTPLRLSMFEPMVDSRSITEGKDVAGMA |
| Ga0070766_104528131 | 3300005921 | Soil | NFDDRASRSPLVMKTRGIVLQGLDFGKDRDAEQGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0066696_103976631 | 3300006032 | Soil | NSDDRASRSPLVMKTRGIVLQGLDFGKGRAAEPGTPLRLSMFEPMVDSRSITEGKDVAGMAE* |
| Ga0075028_1004730612 | 3300006050 | Watersheds | MKTRGIVLQGLDFGRGRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0075029_1000831402 | 3300006052 | Watersheds | MKTRGIVLQGLEFGKDRMPSTSLYLRLSMVDPMVDSRSITEGKDVAGMAE* |
| Ga0075026_1009476652 | 3300006057 | Watersheds | MKTRGIVLQGVDFGKGRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0075527_100343601 | 3300006640 | Arctic Peat Soil | PLVMKTRGIVLQGLDFGKDRDFGRGTPLRLSMFDLMVDSRSITEGKDVAGMAE* |
| Ga0075521_100945511 | 3300006642 | Arctic Peat Soil | MKTRGIILQGLDFGKDRDFGRGTPLRLSMFDLMVDSRFITEGKDVAGMAE* |
| Ga0075521_101137332 | 3300006642 | Arctic Peat Soil | MKTRGIVLQGLDFGKDRDGERGTPLQLSMSDPMVDSRSITEGKDVAGMAE* |
| Ga0066665_100326731 | 3300006796 | Soil | LQGLDFGKDRDAEPGTPLRLSMFEPMVDSRSITEGKDVAGMAE |
| Ga0066665_102069482 | 3300006796 | Soil | ATRSPLVMKTRGIVLQGLDFGKIRDAEHNTPPPVVDVRPMIHSCSITEDKDVAGMAE* |
| Ga0075425_1015276201 | 3300006854 | Populus Rhizosphere | MKTRGIVLQGLDFGKGTAAEHGTPQRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0099793_101121801 | 3300007258 | Vadose Zone Soil | MKTRGIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0099828_109326411 | 3300009089 | Vadose Zone Soil | NFDDRASRSPLVMKTRGIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0099827_102510402 | 3300009090 | Vadose Zone Soil | MKTRGIVLQGLDFGKNRDAEHGTPRRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0066709_1001351351 | 3300009137 | Grasslands Soil | MKTRGIVLQGLDFGKDRDAEPGTPLRLSMFEPMVDSRSITEGKDVAGMAE |
| Ga0116221_11591192 | 3300009523 | Peatlands Soil | MKTRGIVLQGLDFGKDRDGEHSTPLRLSMVDSMVDSRSITEGKDVAGMAE* |
| Ga0116126_10741983 | 3300009640 | Peatland | MKTRGIVLQGLDFGKDSDAEHDTPLRLSVFEPMVDSRSITEGKDVAGMAE* |
| Ga0116217_100426501 | 3300009700 | Peatlands Soil | MKTRGIVLQGLDSGKDRDAEPGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0134071_102475782 | 3300010336 | Grasslands Soil | IVLQRLDFGKGRAAEHGTPLRLSMFDLMVDSRSITEGKDVAGMAE* |
| Ga0137391_102089182 | 3300011270 | Vadose Zone Soil | MKTRGIVLQGLDFGKDRGAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0137393_100323601 | 3300011271 | Vadose Zone Soil | MKTRGIVLQGLDFGKDRDSGHGTPLRLSMFDPMVDSR |
| Ga0137389_115058581 | 3300012096 | Vadose Zone Soil | LDFGKGRDVEHGTPLRLSMLDPMVDSRSITEGKDVAGMAE* |
| Ga0137388_107940971 | 3300012189 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRAAEHGTPLRLSMFDPIVDSRSVTEGKDVAGMAE* |
| Ga0137365_102338372 | 3300012201 | Vadose Zone Soil | MKTRGIVLQGLDFGKGKDAEHGAPLRLSMFDPVVDSRSITEGKDVAGMAE* |
| Ga0137399_101816112 | 3300012203 | Vadose Zone Soil | MKTRGIVSQGLDFGKGKDAEHGALLRLSMFDPMVDSGSITEGKDVAGMAE* |
| Ga0137362_100431281 | 3300012205 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRDAEHGTPLRLSMFHPMVDSRS |
| Ga0137381_101425863 | 3300012207 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRAAEHGTPLRLSMFDPMVDSRSVTEGKDVAGMAE* |
| Ga0137387_102659491 | 3300012349 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRAADHGTPLRLSMFDPMVDSRSVTEGKDVAGMAE* |
| Ga0137371_111167972 | 3300012356 | Vadose Zone Soil | MKTRGIVLQGLDFGKGKDAEHGAPLRLSMFDPVVDSRSITEGK |
| Ga0137385_103662841 | 3300012359 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRAAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0137360_107687382 | 3300012361 | Vadose Zone Soil | IVLHGSDFGKDREAEHGTQLRLSMFDPIVDSSSITEGKDVAGMAE* |
| Ga0137416_100283176 | 3300012927 | Vadose Zone Soil | MKTRGIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMA |
| Ga0137410_107424721 | 3300012944 | Vadose Zone Soil | MKTRGIVLQGLDSGKGRAAEHGTPLRLSMFDPMVDSRSITEGKDVAGMA |
| Ga0167668_10015912 | 3300015193 | Glacier Forefield Soil | MKTRGIVLQGLDLGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE* |
| Ga0187802_100405812 | 3300017822 | Freshwater Sediment | MKTRRIVLQGLDFGKDKDAVHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0187802_101827231 | 3300017822 | Freshwater Sediment | MKTRGIVLQGLDSGKDRDAEHSTPLRLSMFDPMVDSCSITEGKDVAGMAE |
| Ga0187816_104430471 | 3300017995 | Freshwater Sediment | MKTRGIVLQGLDSGKDRDAEHSTPLRLSMFDSMVDSSSTT |
| Ga0187872_100466853 | 3300018017 | Peatland | MKTRGIVLQGLDFGKDSDAEHDTPLRLSVFEPMVDSRSITEGKDVAGMAE |
| Ga0187784_108181202 | 3300018062 | Tropical Peatland | MKARGIVLQGLDFGKDSDAEHGTLLRLSVFEPMVDSRSITEGKNVAGMAE |
| Ga0066662_101804432 | 3300018468 | Grasslands Soil | VMKTRGIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0193729_12025192 | 3300019887 | Soil | MKTRGIVLQGLDLGKDRDAEHGTPLRLSMFHPMVDSLCITEGKDVAGMAE |
| Ga0210406_110700721 | 3300021168 | Soil | MKTRRIVLQGLDFGKDKDALHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0210397_105737343 | 3300021403 | Soil | SPWSGKREASVLQGLDSGKGRDAEHGTPQGVSMFDPMFDSGSINEGKDVAGMAE |
| Ga0210387_100751614 | 3300021405 | Soil | AHPWSGKREASVLQGLDSGKGRDAEHGTPQGVSMFDPMFDSGSINEGKDVAGMAE |
| Ga0208850_10043222 | 3300025457 | Arctic Peat Soil | LQGLDFGKDRDFGRGTPLRLSMFDLMVDSRSITEGKDVAGMAE |
| Ga0208076_10548942 | 3300025464 | Arctic Peat Soil | MKTRGIVLQGLDFGKDRDFGRGTPLRLSMFDLMVDSRSITEGKDVAGMAE |
| Ga0208479_10492492 | 3300025474 | Arctic Peat Soil | LQGLDFGKDRDFGRGTPLRLSMFDLMVDSRFITEGKDVAGMAE |
| Ga0208714_10268313 | 3300025527 | Arctic Peat Soil | MKTRGIVLQGLDFGKDRDGERGTPLQLSMSGPMVDSRSITEGKDVAGMAE |
| Ga0208355_10613531 | 3300025581 | Arctic Peat Soil | LVMKTRGIVLQGLDFGKDRDFGRGTPLRLSMFDLMVDSRSITEGKDVAGMAE |
| Ga0209584_100449861 | 3300025878 | Arctic Peat Soil | MKTRGIVLQGLDFGKDRDGERGTPLQLSMSDPMVDSRSITEGKDVAGMAE |
| Ga0209584_100775552 | 3300025878 | Arctic Peat Soil | IILQGLDFGKDRDFGGGTPLRLSMFDLMVDSRFITEGKDVAGMAE |
| Ga0207684_101671533 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRGIVLRGLDFGKDRDAVHGTPQRLSMFNPMVDSRSITEGKDVAGMAE |
| Ga0207700_112061251 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRGIVLQGPDFGKDRDSGHGTPLRLSMSDPMVDSRSITEGKDVAGMAE |
| Ga0209055_10652852 | 3300026309 | Soil | MKTRGIVLQGLDFGKGRAAEPGTPLRLSMFEPMVDSRSITEGKDVAGMAE |
| Ga0209761_11744342 | 3300026313 | Grasslands Soil | LDDRATRSPLVMKTRGIVLQGLDFGKIRDAEHNTPPPVVDVRPMIHSCSITEDKDVAGMA |
| Ga0209154_10632122 | 3300026317 | Soil | MKTRGIVLQGLDFGKGRDAEHGAPLRLSMFDPVVDSRSITEGKDVAGMAE |
| Ga0257180_10019652 | 3300026354 | Soil | MKTRGIVLQGLDFGKDRGAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0257166_10147591 | 3300026358 | Soil | MKTRGIVLQGLDFGKGRAAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0257178_10008113 | 3300026446 | Soil | MKTRGIVLQGLDFGKDGDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0257169_10033992 | 3300026469 | Soil | MKTGGIVLQGLDLGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0257177_10020552 | 3300026480 | Soil | MKTRGIVLQGLDFGKGRDAEQGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0257172_10358712 | 3300026482 | Soil | MKTRRIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0257156_10081691 | 3300026498 | Soil | LDDRASRSPLVMKTRGIVLLGLDFGKGRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMA |
| Ga0209378_10255883 | 3300026528 | Soil | VTVKTRGIVLQGLDFGKIRDAEHNTPPPVVDVRPMIHSCSITEDKDVAGMAE |
| Ga0209056_101918353 | 3300026538 | Soil | ATRSPLVMKTRGIVLQGLDFGKIRDAEHNTPPPVVDVRPMIHSCSITEDKDVAGMAE |
| Ga0179587_102162372 | 3300026557 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRDGEHGTPMRLSMFDPMVDSRSITEGKDGAGMAE |
| Ga0208603_10254001 | 3300027109 | Forest Soil | MKTRGIVLQGLDFGKDRDAEHSTPLRLSMFDPMVDPGSITEGKDVAGMAE |
| Ga0208984_10168871 | 3300027546 | Forest Soil | MKTRGIVLQGLDFGKGRDAEHGTPLRLSMFDPMVDSGSITEGKDVAGMAE |
| Ga0209523_11147142 | 3300027548 | Forest Soil | LDFDKGRDTEHGTTLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0209219_10727481 | 3300027565 | Forest Soil | MKTRDIVLQGLDFGKGRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0209009_10255112 | 3300027667 | Forest Soil | MKTRGIVLQGLDFGKDRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0209517_101888912 | 3300027854 | Peatlands Soil | MKTRGIVLQGLDSGKDRDAEPGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0209590_102600561 | 3300027882 | Vadose Zone Soil | MKTRGIVLQGLDFGKGRAAEHGTPLRLSMFDPMVDSRSVTEGKDVAGMAE |
| Ga0209488_101840731 | 3300027903 | Vadose Zone Soil | RSPLVMKTRGIVLQGLDFGKGRDVGHGTPLRLSMLDPMVDSRSITEGKDVAGMAE |
| Ga0209415_102308722 | 3300027905 | Peatlands Soil | MKTRGIVLQGLDFGKDRDGEHSTPLRLSMVDSMVDSRSITEGKDVAGMAE |
| Ga0209069_107556031 | 3300027915 | Watersheds | MKTRGIVLQGLDFGKDRDSGHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0137415_100371153 | 3300028536 | Vadose Zone Soil | MKTRGIVSQGLDFGKGKDAEHGALLRLSMFDPMVDSGSITEGKDVAGMAE |
| Ga0308309_111092811 | 3300028906 | Soil | GLDFGKGRDAEHGTALRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0310039_102085341 | 3300030706 | Peatlands Soil | MKTRGIVLQGLDSGKDRDAEAGTPLRLSVFEPMVDSRSITEGKDVAGMAE |
| Ga0310038_101086533 | 3300030707 | Peatlands Soil | MKTRGIVLQGLDSGKDRDAEPGTPLRLSMFDPMVDS |
| Ga0265753_10743261 | 3300030862 | Soil | MKTRGIVLQGLDFGKDRDAEQSTPLRLSMFDPMVDPGSITEGKDVAGMAE |
| Ga0265760_103758071 | 3300031090 | Soil | MIALRAPLVMKTRGIVLQRLDFGKGRDAEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0307475_103450441 | 3300031754 | Hardwood Forest Soil | MKMRGIVLQGLDFGKGRDVEHGTPLRLSMLDPMVDSRSITEGKDVAGMAE |
| Ga0307473_102410692 | 3300031820 | Hardwood Forest Soil | DRASPSPLVMKTRGIVLQGLDFGKGRDAEHGTPLRLSMFDSMVDSRSITEGKEVAGMAE |
| Ga0307479_100255507 | 3300031962 | Hardwood Forest Soil | MKTRGIVLQGHYFGKDRDAENNSPLRLSMLDPKVDSRSITEGKDVAGMAE |
| Ga0307470_100900022 | 3300032174 | Hardwood Forest Soil | MKTRGIVLQGLDFGKGRDAEHGTPLRLSMFDSMVDSRSITEGKEVAGMAE |
| Ga0326726_100256823 | 3300033433 | Peat Soil | MKTRGIALQGLDFGKGGDVEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| Ga0370484_0014476_898_1050 | 3300034125 | Untreated Peat Soil | MKTRGIVSQGLDFGKNKGCEHGTPLRLSMFDPMVDSRSITEGKDVAGMAE |
| ⦗Top⦘ |