 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F091033 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VVHDNPPEYLNYLQTGTDLGNSRIMSYKEFEDTVLASS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.17 % |
| % of genes near scaffold ends (potentially truncated) | 41.67 % |
| % of genes from short scaffolds (< 2000 bps) | 38.89 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.148 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.21% β-sheet: 3.03% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF10263 | SprT-like | 91.67 |
| PF04851 | ResIII | 3.70 |
| PF00520 | Ion_trans | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.15 % |
| All Organisms | root | All Organisms | 1.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.04% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.19% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.33% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.63% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.85% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.85% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.85% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.85% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.93% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.93% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.93% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000325 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100m | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020346 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556057-ERR599069) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020384 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556023-ERR599110) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023237 | Saline water microbial communities from Ace Lake, Antarctica - #367 | Environmental | Open in IMG/M |
| 3300023242 | Saline water microbial communities from Ace Lake, Antarctica - #1576 | Environmental | Open in IMG/M |
| 3300023273 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025665 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028706 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_100m | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031646 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1 | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031693 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_33.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SI39nov09_100mDRAFT_10331771 | 3300000325 | Marine | HDNPPEYLNHLQTGTDLGNSKVITYAEFEKILAPSKS* |
| JGI20152J14361_100176864 | 3300001344 | Pelagic Marine | NYTVVHDNPPEYLNYLQTGTDLGNSRIISYKEFEETVLASS* |
| JGI20159J14440_100911483 | 3300001353 | Pelagic Marine | DNPPEYLNYLQTGTDLGNSRIMSYKEFEETVLASS* |
| JGI20159J14440_101289143 | 3300001353 | Pelagic Marine | HDNPPEYMHNVQTGTDLGNSKIISYKEFEKVLAPS* |
| JGI11705J14877_100243444 | 3300001419 | Saline Water And Sediment | VNYTIVHDDPPSYLKHLQTGTDLGNSKVITYKEFETVLTP* |
| Ga0065861_11040321 | 3300004448 | Marine | MSTTSVVHDNPPEYINNVQTGTDNGNSKIISYKEFEDTVLAGS* |
| Ga0066865_103522651 | 3300005523 | Marine | VVHDDPPEYMENFQTGTDLGNSKVISYDEFEKVLTP* |
| Ga0078893_106801881 | 3300005837 | Marine Surface Water | YIVVHDNPPTYMNHLQTGTDLGNSKVITYKEFEKILTP* |
| Ga0075474_101698802 | 3300006025 | Aqueous | IVHDNPPSFLHNLQTGTDLGNSKIMSYSEFEKVLTP* |
| Ga0098058_11593751 | 3300006750 | Marine | TIVHDNPPEYLYHLQTGTDLGNSHLMTYKEFNDKVINRQPQI* |
| Ga0075476_102444611 | 3300006867 | Aqueous | VVHDNPPEYLNYLQTGTDLGNSRIMSYKEFEDTVLASS* |
| Ga0075481_100343731 | 3300006868 | Aqueous | HDNPPSFLHNLQTGTDLGNSKIISYSEFEKVLTPR* |
| Ga0075481_102510212 | 3300006868 | Aqueous | DNPPEYLNYLQTGTDLGNSRIMSYKEFEDTVLAGS* |
| Ga0070750_102562681 | 3300006916 | Aqueous | VNYTVVHDNPPEYLHHLQTGTDLGNSGIMSYKEFEDTVLAGS* |
| Ga0075444_102214183 | 3300006947 | Marine | DNPPEYMHNVQTGTDMGNSSIMSYKEFEETVLASS* |
| Ga0075110_10313851 | 3300007074 | Saline Lake | VNYTVVHDDPPEYMNHLQTGTDHGNSKVISYKEFEETVLTSS* |
| Ga0075468_101970932 | 3300007229 | Aqueous | HDNPPDFMNYLQTGTDHGNSKVISYRQFEDTVLAGS* |
| Ga0099851_13622492 | 3300007538 | Aqueous | HDNPPNFLHNLQTGTDLGNSRIISYSQFEKVLTP* |
| Ga0115566_105109312 | 3300009071 | Pelagic Marine | YVNYTVVHDNPPEYLNYMQTGTDLGNSRIMNYKEFEDTVLAGS* |
| Ga0114995_100295691 | 3300009172 | Marine | YIMVHDNPPEYMHNVQTGTDMGNSSIISYKEFEDTVLASS* |
| Ga0114995_108194382 | 3300009172 | Marine | VHDDPPEFLNYLQTGTDNGNSKVISYKEFEDTVLAGS* |
| Ga0114993_108412472 | 3300009409 | Marine | NYIMVHDHPPEYMHNVQTGTDMGNSSIMSYKEFEETVLASS* |
| Ga0114998_103677471 | 3300009422 | Marine | NYIMVHDNPPEYMHNVQTGTDMGNSSIISYKEFEETVLTSS* |
| Ga0114997_106137572 | 3300009425 | Marine | LRPDVNFIMVHDDPPEYMHNVQTGTDMGNSSIMSYEEFEKVLAPS* |
| Ga0115553_13626222 | 3300009445 | Pelagic Marine | VNYTVVHDNPPEYLNYLQTGTDLGNSKTITYKEFEDTVLSGS* |
| Ga0115568_102775583 | 3300009498 | Pelagic Marine | DNPPEYLNYLQTGTDLGNSKVISYTEFEKVLTPR* |
| Ga0115003_105608631 | 3300009512 | Marine | DPPEYMHNVQTGTDMGNSSIISYKEFEDTVLAGSGKI* |
| Ga0115003_106150872 | 3300009512 | Marine | DHPPEYMHNVQTGTDMGNSSIMSYKEFEETVLASS* |
| Ga0115000_105269501 | 3300009705 | Marine | IMVHDNPPEYMHNVQTGTDMGNSSIMSYKEFEETVLASS* |
| Ga0115000_105490251 | 3300009705 | Marine | PYVNYIMVHDNPPEYMHNVQTGTDMGNSSIISYKEFEDTVLASS* |
| Ga0115000_105788381 | 3300009705 | Marine | VHDNPPEYMHNVQTGTDMGNSSIISYKEFEETVLTSS* |
| Ga0115002_109407891 | 3300009706 | Marine | NYTVVHDDPPEFLNYLQTGTDHGNSKVISYKEFEDTVLAGS* |
| Ga0098049_10734241 | 3300010149 | Marine | HDNPPEYMHSLQTGTDLGNSKVISYAEFEKVLASS* |
| Ga0129348_11526133 | 3300010296 | Freshwater To Marine Saline Gradient | YTIVHDNPPSFLKNLQTGTDLGNSKIISYSEFEKVLTP* |
| Ga0163110_114575212 | 3300012928 | Surface Seawater | VNYTVVHDNPPEYLYYLQTGNDLGNTKVISYNEFEKVLTP* |
| Ga0181373_10403571 | 3300017721 | Marine | VNYTVVHDNPPEYMHSLQTGTDLGNSKVISYAEFEKVLAPS |
| Ga0181401_11471802 | 3300017727 | Seawater | HDNPPDYMNHLQTGTDLGNSRVITYAEFEKELASAQT |
| Ga0181419_10363413 | 3300017728 | Seawater | YTVVHDNPPEYMNYFQTGTDLGNSKVITYAEFEKIIST |
| Ga0181396_10670631 | 3300017729 | Seawater | NYTVVHDNPPKYLDHLQTGSDLGNSKVISYAEFEKVLTS |
| Ga0181402_10973091 | 3300017743 | Seawater | HDSPPEYLGYLQTGTDLGNSKVISYREFEDTVLTSSR |
| Ga0181393_11442711 | 3300017748 | Seawater | REDVVHDSPPEYLNHLQTGTDLGNSKVISYSEFEKVLTSRQA |
| Ga0181392_11902411 | 3300017749 | Seawater | VHDNPPEYMKHLQTGTDLGNSRILSYAEFEKELTP |
| Ga0181420_11309341 | 3300017757 | Seawater | TVVHDNPPDYLNYLQTGTDLGNSKVISYKEFEDTVLTSSR |
| Ga0181409_12485112 | 3300017758 | Seawater | FTVVHDNPPEYLQYLQTGTDYGNSRVISYAELDKELTP |
| Ga0181406_11434523 | 3300017767 | Seawater | TVVHNNPPEYMSNFQTGADLGNSKVISYAEFENVLTPS |
| Ga0187221_11949511 | 3300017769 | Seawater | DSPPEYMNHLQTGTDLGNSRVITYAEFEKELTPSQA |
| Ga0181386_11053901 | 3300017773 | Seawater | DNPPEYLNYLQTGTDLGNSKVISYAEFEKILAPSKA |
| Ga0181395_10580603 | 3300017779 | Seawater | VHYTVVHDNPPEYMNNLQTGTDFGNSKVISYSEFEKVLTPS |
| Ga0181423_13804821 | 3300017781 | Seawater | VVHNNPPEYMSNFQTGADLGNSKVISYAEFEEVLTPS |
| Ga0181552_104179922 | 3300017824 | Salt Marsh | YTVVHDDPPDYMNYLQTGTDLGNTKVISYAEFEKVLAP |
| Ga0181577_101767843 | 3300017951 | Salt Marsh | CKVTIVHDDPPDYLNRLQTGTYLGNSEIITYADFEKILTPSEA |
| Ga0181577_107090822 | 3300017951 | Salt Marsh | HDNPPDYLYRLQTGTDLGNSKVIRYAEFEKVLAPSKS |
| Ga0181577_108530492 | 3300017951 | Salt Marsh | YTLVHDNPPEYLNHLQTGTDLGNSKVISYAEFEKVLTP |
| Ga0181585_101150481 | 3300017969 | Salt Marsh | NYTVVHDNPPEYLNYLQTGTDLGNSKVISYAEFEKVLTP |
| Ga0181585_102403191 | 3300017969 | Salt Marsh | RPYCHFTVVHDNPPEYFRHLQTGTDLKNTSVMSYKEFNETVLGRAF |
| Ga0181568_101590781 | 3300018428 | Salt Marsh | IVHDNPPVYLNHLQTGTDLGNSKVITYAEFEKVLTP |
| Ga0181604_103393092 | 3300020191 | Salt Marsh | TVVHDNPPEYLNHLQTGTDLGNSKIITYKEFEDTVLAGS |
| Ga0211483_101636371 | 3300020281 | Marine | DNPPEFLNHLQTGTDLKNSHVISYEKFNDVVSAQH |
| Ga0211607_11226791 | 3300020346 | Marine | TVVHDNPPDYLRHLQTGTDLGNSRVINYKEFEKILTPGQV |
| Ga0211527_102185442 | 3300020378 | Marine | IVHDNPPEYMKHLQTGADLGNSRVISYAEFEKELTPS |
| Ga0211498_100899191 | 3300020380 | Marine | YCNFTVVHDDPPEYLHHLQTGTDLGNSRVINYKTFTDEVLGLHS |
| Ga0211596_101521921 | 3300020384 | Marine | VVHDNPPEYMKHLQTGENLGNSKVISYAEFEKVLTPS |
| Ga0211705_100184671 | 3300020395 | Marine | IVHDDPPDYMGHLQTGTDLGNSNVISFKEFDEVLTS |
| Ga0211499_100457621 | 3300020402 | Marine | VHDDPPEYLHHLQTGTDLGNTRVISYDELDKELTPSKI |
| Ga0211659_100183374 | 3300020404 | Marine | YTVVHDNPPEYLNHLQTGTDLGNSRVISYAEFEKILAPSKA |
| Ga0211659_102168413 | 3300020404 | Marine | VHDDPPDYMNHLQTGTDLGNSRVITYAEFEKELTPSQA |
| Ga0211565_100483433 | 3300020433 | Marine | TVVHDNPPDYLNHLQTGTDLGNSRIINYKQFNDEVINQQN |
| Ga0211708_102371353 | 3300020436 | Marine | INFTIVHDDPPEYMNHLQTGTNLGNSKVINYTEFEKILTP |
| Ga0211576_104869761 | 3300020438 | Marine | NYTVVHDNPPDYLNYLQTGTDLGNSKVMSYKEFEDTVLTGS |
| Ga0211564_102033621 | 3300020445 | Marine | TMVHDNPPEFMHNVQTGTDLGNSSLMTYKEFTDEVLTRAV |
| Ga0211535_101334753 | 3300020461 | Marine | TVVHDNPPEYMNYFQTGTDLGNSKLISYNEFEKVLTP |
| Ga0211676_106129042 | 3300020463 | Marine | NPPEFMNYLQTGTDLGNSKIISYAEFEKVLAPGQA |
| Ga0211475_100252954 | 3300020468 | Marine | DNPPEYLNHMQTGTDLGNSKLMTYREFNDTILNQTP |
| Ga0211577_101427961 | 3300020469 | Marine | YIMVHDNAPEYMHNVQTGTDLGNSKIISYDEFNDVVSNRKS |
| Ga0213862_103765881 | 3300021347 | Seawater | VVHDNPPEYLNHLQTGTDLGNSRVITYAEFEKVLTP |
| Ga0213868_106690581 | 3300021389 | Seawater | YTVVHDNPPEYLNYLQTGTDLGNSRIMSYKEFEDTVLAGS |
| Ga0222713_104943793 | 3300021962 | Estuarine Water | YCHFTVVHNDPPEYFSHLQTGTDLKNTSVMSYKEFNDTVLNRAS |
| Ga0222713_106084902 | 3300021962 | Estuarine Water | VVHDNPPEFLNHLQTGIDLGNTSLMNYNEFKTKVLNQDV |
| Ga0196905_11411142 | 3300022198 | Aqueous | LVHDNPPEYFNHMQTGTDLKNTFKMTYAEFKKKVLNQTV |
| Ga0196901_10811563 | 3300022200 | Aqueous | PYCHFTVVHNNPPEYLRHLQTGTDLKNTSVMSYKEFNEIVLGRVS |
| Ga0255770_103412181 | 3300022937 | Salt Marsh | CHFTVVHDNPPDYLNYLQTGTDLKNTTLMTFKDFNDKVLNRGS |
| Ga0255772_104337272 | 3300023176 | Salt Marsh | HDNPPDYLNYLQTGTDLGNTFLMTYDQFNDKVLNRTF |
| Ga0222650_10522322 | 3300023237 | Saline Water | YTVVHDDPPEYLKHLQTGTDLGNSKVIGYKEFEDTVLAGS |
| Ga0222708_10105583 | 3300023242 | Saline Water | NFTLVHDNPPEYFNHMQTGTDLKNTFKMTYAEFNNKVLNQAG |
| Ga0255763_11009743 | 3300023273 | Salt Marsh | VHDNPPEYLNYLQTGTDLGNSKVISYAEFEKVLTP |
| Ga0209535_10533171 | 3300025120 | Marine | DNPPDYFNYLQTGTDLGNSKVISYKEFEDTVLASS |
| Ga0209336_101124833 | 3300025137 | Marine | NYIMVHDNPPEYMHNVQTGTDMGNSSIISYKEFEETVLTSS |
| Ga0208770_10865602 | 3300025438 | Saline Lake | VSYTVVHDDPPEYLKHLQTGTDLGNSKVIGYKEFEDTVLAGS |
| Ga0209360_11894191 | 3300025665 | Marine | YTVVHDNPPDYLNYLQTGTDLGNSRVINYKEFEKVLTP |
| Ga0209603_12423902 | 3300025849 | Pelagic Marine | VNYTVVHDNPPEYLNYLQTGTDLGNSRIMSYKEFE |
| Ga0209309_100687721 | 3300025881 | Pelagic Marine | VNYTVVHDNPPEYLNYLQTGTDLGNSRIMSYKEFEETVLASS |
| Ga0209632_103939022 | 3300025886 | Pelagic Marine | PYINYTVVHDNPPSYLNNLQTGTDLGNSRVINYKEFEDTVLASS |
| Ga0208763_10585101 | 3300026136 | Marine | YTVVHDNPPEYMHSLQTGTDLGNSKVISYAEFEKVLAPS |
| Ga0209617_102307653 | 3300027720 | Freshwater And Sediment | IVVHDNPPEPLHHLQTGIDLKNTKLMTYAEFTEKVLGR |
| Ga0209296_13393421 | 3300027759 | Freshwater Lake | TVVHDNPPEYLNHLQTGTDLKNTRLMNYKEFTEKVLGR |
| Ga0209709_104069382 | 3300027779 | Marine | NYIMVHDNPPEYMHNVQTGTDMGNSSIMSYKEFEDTVLAGS |
| Ga0209830_100160717 | 3300027791 | Marine | PYVNYIMVHDNPPEYMHNVQTGTDMGNSSIISYKEFEDTVLASS |
| Ga0209090_103349113 | 3300027813 | Marine | YIMVHNNPPEYMHNVQTGTDMGNSSIMSYKEFEETVLASS |
| Ga0209089_101221593 | 3300027838 | Marine | YIMVHDNPPEYMHNVQTGTDMGNSSIISYKKFEETVLTSS |
| Ga0257106_11651343 | 3300028194 | Marine | YDDPPEYMHNVQTGTDMGNSSIMSYEEFEKVLAPS |
| Ga0304728_12191873 | 3300028393 | Freshwater Lake | CQFTVVHDNPPNFLNHLQTGTDLKNTRLMTYEEFTKKVLNQ |
| Ga0257115_11541021 | 3300028706 | Marine | NYTVVHDNPPEYLNHLQTGTDLGNSKVITYAEFEKILAPSKS |
| Ga0302135_101636601 | 3300031625 | Marine | MVHDNPPEYMHNVQTGTDMGNSSIMSYKEFEDTVLAGS |
| Ga0302135_103135022 | 3300031625 | Marine | MVHDNPPEYMHNVQTGTDMGNSSIMSYKEFEETVLASS |
| Ga0302121_100899233 | 3300031626 | Marine | MVHDNPPEYMQNVQTGTDLGNSSIMSYKEFEETVLASS |
| Ga0302133_102633771 | 3300031646 | Marine | VHDNAPEYMQNVQTGTDLGNSSIMSYKEFEETVLASS |
| Ga0302122_100955491 | 3300031675 | Marine | YIMVHDNPPEYMHNVQTGTDMGNSSIISYKEFEETVLASS |
| Ga0302139_102038361 | 3300031693 | Marine | YTVVHDSPPDFMNYLQTGTDLGNSFLMSYKEFEDTVLSSS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |