| Basic Information | |
|---|---|
| Family ID | F090967 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRLNPDPAA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.07 % |
| % of genes near scaffold ends (potentially truncated) | 98.15 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.185 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (22.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.111 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 12.96 |
| PF00174 | Oxidored_molyb | 10.19 |
| PF07589 | PEP-CTERM | 8.33 |
| PF02631 | RecX | 2.78 |
| PF01292 | Ni_hydr_CYTB | 1.85 |
| PF04264 | YceI | 1.85 |
| PF14748 | P5CR_dimer | 0.93 |
| PF01293 | PEPCK_ATP | 0.93 |
| PF00440 | TetR_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 12.96 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 12.96 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 10.19 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 10.19 |
| COG2137 | SOS response regulatory protein OraA/RecX, interacts with RecA | Posttranslational modification, protein turnover, chaperones [O] | 2.78 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 1.85 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.85 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 1.85 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 1.85 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 1.85 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 1.85 |
| COG1866 | Phosphoenolpyruvate carboxykinase, ATP-dependent | Energy production and conversion [C] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.19 % |
| All Organisms | root | All Organisms | 39.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10209188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300001593|JGI12635J15846_10379771 | Not Available | 858 | Open in IMG/M |
| 3300002908|JGI25382J43887_10421444 | Not Available | 564 | Open in IMG/M |
| 3300004080|Ga0062385_11038689 | Not Available | 552 | Open in IMG/M |
| 3300004082|Ga0062384_101176262 | Not Available | 556 | Open in IMG/M |
| 3300004091|Ga0062387_101069985 | Not Available | 623 | Open in IMG/M |
| 3300004152|Ga0062386_100046303 | All Organisms → cellular organisms → Bacteria | 3267 | Open in IMG/M |
| 3300004152|Ga0062386_100398481 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300004152|Ga0062386_100948161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 712 | Open in IMG/M |
| 3300004152|Ga0062386_101434686 | Not Available | 575 | Open in IMG/M |
| 3300005552|Ga0066701_10628152 | Not Available | 651 | Open in IMG/M |
| 3300005557|Ga0066704_11039827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 505 | Open in IMG/M |
| 3300005591|Ga0070761_10465168 | Not Available | 777 | Open in IMG/M |
| 3300005995|Ga0066790_10447737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 552 | Open in IMG/M |
| 3300009038|Ga0099829_10816023 | Not Available | 775 | Open in IMG/M |
| 3300009088|Ga0099830_10138864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1858 | Open in IMG/M |
| 3300009090|Ga0099827_12006331 | Not Available | 502 | Open in IMG/M |
| 3300009143|Ga0099792_11061642 | Not Available | 544 | Open in IMG/M |
| 3300009521|Ga0116222_1536332 | Not Available | 513 | Open in IMG/M |
| 3300009523|Ga0116221_1368453 | Not Available | 624 | Open in IMG/M |
| 3300009624|Ga0116105_1205285 | Not Available | 545 | Open in IMG/M |
| 3300009644|Ga0116121_1027436 | Not Available | 1807 | Open in IMG/M |
| 3300009762|Ga0116130_1161432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300010048|Ga0126373_11746306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 686 | Open in IMG/M |
| 3300010343|Ga0074044_10057894 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300010343|Ga0074044_10669405 | Not Available | 677 | Open in IMG/M |
| 3300010343|Ga0074044_11176031 | Not Available | 500 | Open in IMG/M |
| 3300010379|Ga0136449_104030188 | Not Available | 548 | Open in IMG/M |
| 3300012189|Ga0137388_10106928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2414 | Open in IMG/M |
| 3300012202|Ga0137363_11403051 | Not Available | 588 | Open in IMG/M |
| 3300012203|Ga0137399_10398034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300012205|Ga0137362_11622154 | Not Available | 534 | Open in IMG/M |
| 3300012363|Ga0137390_11014151 | Not Available | 781 | Open in IMG/M |
| 3300012582|Ga0137358_10193890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300012683|Ga0137398_10439210 | Not Available | 892 | Open in IMG/M |
| 3300012917|Ga0137395_10168589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1509 | Open in IMG/M |
| 3300012927|Ga0137416_11169036 | Not Available | 692 | Open in IMG/M |
| 3300014158|Ga0181521_10023132 | All Organisms → cellular organisms → Bacteria | 5058 | Open in IMG/M |
| 3300014165|Ga0181523_10018485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4695 | Open in IMG/M |
| 3300014638|Ga0181536_10160751 | Not Available | 1167 | Open in IMG/M |
| 3300014654|Ga0181525_10898033 | Not Available | 503 | Open in IMG/M |
| 3300016702|Ga0181511_1330486 | Not Available | 519 | Open in IMG/M |
| 3300017924|Ga0187820_1206632 | Not Available | 615 | Open in IMG/M |
| 3300017931|Ga0187877_1055849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1780 | Open in IMG/M |
| 3300017931|Ga0187877_1103877 | Not Available | 1184 | Open in IMG/M |
| 3300017938|Ga0187854_10049864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2096 | Open in IMG/M |
| 3300017943|Ga0187819_10603088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300018003|Ga0187876_1184898 | Not Available | 707 | Open in IMG/M |
| 3300018004|Ga0187865_1024963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2710 | Open in IMG/M |
| 3300018008|Ga0187888_1222363 | Not Available | 742 | Open in IMG/M |
| 3300018012|Ga0187810_10069746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1349 | Open in IMG/M |
| 3300018012|Ga0187810_10317151 | Not Available | 647 | Open in IMG/M |
| 3300018013|Ga0187873_1334229 | Not Available | 554 | Open in IMG/M |
| 3300018019|Ga0187874_10181169 | Not Available | 881 | Open in IMG/M |
| 3300018019|Ga0187874_10433316 | Not Available | 529 | Open in IMG/M |
| 3300018021|Ga0187882_1381073 | Not Available | 536 | Open in IMG/M |
| 3300018021|Ga0187882_1429776 | Not Available | 500 | Open in IMG/M |
| 3300018022|Ga0187864_10052771 | Not Available | 2273 | Open in IMG/M |
| 3300018022|Ga0187864_10073698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1836 | Open in IMG/M |
| 3300018023|Ga0187889_10190265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300018024|Ga0187881_10376769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 583 | Open in IMG/M |
| 3300018026|Ga0187857_10169852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300018033|Ga0187867_10218529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1079 | Open in IMG/M |
| 3300018037|Ga0187883_10061005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
| 3300018042|Ga0187871_10342208 | Not Available | 827 | Open in IMG/M |
| 3300018042|Ga0187871_10407804 | Not Available | 751 | Open in IMG/M |
| 3300018047|Ga0187859_10460303 | Not Available | 704 | Open in IMG/M |
| 3300018062|Ga0187784_10788420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 759 | Open in IMG/M |
| 3300018062|Ga0187784_10948465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 684 | Open in IMG/M |
| 3300019082|Ga0187852_1261596 | Not Available | 697 | Open in IMG/M |
| 3300019082|Ga0187852_1425734 | Not Available | 516 | Open in IMG/M |
| 3300019787|Ga0182031_1411875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3066 | Open in IMG/M |
| 3300020581|Ga0210399_10025260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4721 | Open in IMG/M |
| 3300020583|Ga0210401_10258214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1602 | Open in IMG/M |
| 3300021168|Ga0210406_11233182 | Not Available | 542 | Open in IMG/M |
| 3300021402|Ga0210385_11231474 | Not Available | 574 | Open in IMG/M |
| 3300021433|Ga0210391_10466136 | Not Available | 991 | Open in IMG/M |
| 3300022521|Ga0224541_1011723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300023250|Ga0224544_1071602 | Not Available | 505 | Open in IMG/M |
| 3300024240|Ga0224522_1053573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 979 | Open in IMG/M |
| 3300026223|Ga0209840_1031529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300026294|Ga0209839_10086547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300026355|Ga0257149_1044813 | Not Available | 635 | Open in IMG/M |
| 3300026551|Ga0209648_10127452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2043 | Open in IMG/M |
| 3300027587|Ga0209220_1068545 | Not Available | 941 | Open in IMG/M |
| 3300027648|Ga0209420_1137472 | Not Available | 675 | Open in IMG/M |
| 3300027667|Ga0209009_1035808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300027701|Ga0209447_10161685 | Not Available | 615 | Open in IMG/M |
| 3300027737|Ga0209038_10166149 | Not Available | 669 | Open in IMG/M |
| 3300027812|Ga0209656_10473038 | Not Available | 551 | Open in IMG/M |
| 3300027825|Ga0209039_10207458 | Not Available | 794 | Open in IMG/M |
| 3300027853|Ga0209274_10393188 | Not Available | 716 | Open in IMG/M |
| 3300027884|Ga0209275_10774479 | Not Available | 553 | Open in IMG/M |
| 3300027889|Ga0209380_10311454 | Not Available | 924 | Open in IMG/M |
| 3300028798|Ga0302222_10176432 | Not Available | 839 | Open in IMG/M |
| 3300029993|Ga0302304_10031077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2212 | Open in IMG/M |
| 3300030003|Ga0302172_10120773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 805 | Open in IMG/M |
| 3300030014|Ga0302175_10111136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 630 | Open in IMG/M |
| 3300030520|Ga0311372_12998763 | Not Available | 511 | Open in IMG/M |
| 3300030617|Ga0311356_11499678 | Not Available | 610 | Open in IMG/M |
| 3300031028|Ga0302180_10330726 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031236|Ga0302324_102806976 | Not Available | 586 | Open in IMG/M |
| 3300031236|Ga0302324_103086905 | Not Available | 551 | Open in IMG/M |
| 3300031726|Ga0302321_101141522 | Not Available | 891 | Open in IMG/M |
| 3300032160|Ga0311301_10857818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1233 | Open in IMG/M |
| 3300032163|Ga0315281_11546030 | Not Available | 649 | Open in IMG/M |
| 3300032805|Ga0335078_11857966 | Not Available | 652 | Open in IMG/M |
| 3300033486|Ga0316624_11526413 | Not Available | 614 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 22.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.04% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 10.19% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024240 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25 | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102091883 | 3300000567 | Peatlands Soil | MLLLKYLLLSAGIAMFVIAAGILSYDACLLIAYRR |
| JGI12635J15846_103797711 | 3300001593 | Forest Soil | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRLNPDPAA |
| JGI25382J43887_104214443 | 3300002908 | Grasslands Soil | MLFLKYLLVGAGILMFVVAAGILTYDFYLLLAYRRARLGPLS |
| Ga0062385_110386891 | 3300004080 | Bog Forest Soil | MLLLKYLLLCMGIGMFVIAAGILSYDAYLLLAWQRRRLHPDPEAGAPGPAPA |
| Ga0062384_1011762621 | 3300004082 | Bog Forest Soil | MLSLKYLLLSAGIAMFVIAAGILSYDAYLLISWQRKRLNPDP |
| Ga0062387_1010699851 | 3300004091 | Bog Forest Soil | MLLLKYLLLYAGIAMFVIAAGILSYDAYLLIAWQRRRLHPDPESGALGPALGLAPGLR |
| Ga0062386_1000463036 | 3300004152 | Bog Forest Soil | MLLLKYLLLSAGIAMFTIAAGVLTYDAYLLIAYQRRRLHLDPANGE |
| Ga0062386_1003984811 | 3300004152 | Bog Forest Soil | MPSLNHLLLGTGIAMFAIAAAILTCDAYLLISDHRGRWNFNPETGTP |
| Ga0062386_1009481611 | 3300004152 | Bog Forest Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIAYRRKRLNFDPQAGTPPPGPVPTVR |
| Ga0062386_1014346861 | 3300004152 | Bog Forest Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIAWQRRRLNFRPE |
| Ga0066701_106281521 | 3300005552 | Soil | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQR |
| Ga0066704_110398271 | 3300005557 | Soil | MLFLKYLLLTAGIAMFVIAAGILAYDAYLLIAWQRRRLNLNPAAGAPEPAPAIRW |
| Ga0070761_104651681 | 3300005591 | Soil | MLLLKYLLVSAGIAMFVIAAGILTYDAYLLLAWQRRRLHPEPEAGAAALPLGFA |
| Ga0066790_104477371 | 3300005995 | Soil | MLLLKYLLLSAGIAMFVIAAGILAYDAYLLISYQR |
| Ga0099829_108160233 | 3300009038 | Vadose Zone Soil | MLFLKYLLLTAGIAMFVIAAGILTYDAYLLIAWQRRRLNLD |
| Ga0099830_101388641 | 3300009088 | Vadose Zone Soil | MLLLKYLLVSAGILMFVVAAGILTYDLYLLLAYRRA |
| Ga0099827_120063312 | 3300009090 | Vadose Zone Soil | MLLLKYLLLSAGIAMFVIAAGILVYDAYLLIAYQRRRLNLDPSAGAPG |
| Ga0099792_110616421 | 3300009143 | Vadose Zone Soil | MLLLKYLLVGAGITMFVVAAGILTYDLYLLLAYRRARLAP |
| Ga0116222_15363321 | 3300009521 | Peatlands Soil | MLLLKYFLLSAGIAMFVIAAGILTYDAYLLIAWQRRRSN |
| Ga0116221_13684532 | 3300009523 | Peatlands Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIAWHRRRLNFDPEAGTP |
| Ga0116105_12052852 | 3300009624 | Peatland | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIAYQRRRLHPDPE |
| Ga0116121_10274364 | 3300009644 | Peatland | MLLLKYLLLSAGIAMFVTAAGILTYDAYLLITYRRRRLNFDPEAGTSGP |
| Ga0116130_11614323 | 3300009762 | Peatland | MLWLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRS |
| Ga0126373_117463061 | 3300010048 | Tropical Forest Soil | MLLLKYLLLGAGIGMFVISAGMLLYDAYMFVAYRRS |
| Ga0074044_100578941 | 3300010343 | Bog Forest Soil | MLLLKYLLLSAGIAMFAIAAGILTYDAYLLIAYRRRRLNF |
| Ga0074044_106694051 | 3300010343 | Bog Forest Soil | MLLLKYLLLSAGIAMFAIAAGILTYNAYLLIAWQRRRLHFRPDTGTPGGAPGVDP |
| Ga0074044_111760311 | 3300010343 | Bog Forest Soil | MLLLKYLLMSAGIAMFVIAAGILSYDAYLLIAWQRRR |
| Ga0136449_1040301881 | 3300010379 | Peatlands Soil | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRLNFDPEAGTPGPAPGLAP |
| Ga0137388_101069285 | 3300012189 | Vadose Zone Soil | MLFLKYLLLTAGIAMFVIAAGILTYDAYLLIAWQRKRMSFDPAGGPPGPAPA |
| Ga0137363_114030511 | 3300012202 | Vadose Zone Soil | MLLLKYLLLSTGIAMFVIAAGILAYDAYLLIAWQRRRLNLD |
| Ga0137399_103980343 | 3300012203 | Vadose Zone Soil | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRSNLDPAAGAPEPAPAIRWR |
| Ga0137362_116221541 | 3300012205 | Vadose Zone Soil | MLLLKYLLLTAGIAMFVIAAGILTYDAYLFIAYQR |
| Ga0137390_110141513 | 3300012363 | Vadose Zone Soil | MLLLKYLLLTAGIAMFVIAAGILSYDAYLLIAWHRRRLNFDPAAG |
| Ga0137358_101938903 | 3300012582 | Vadose Zone Soil | MLLLNYLLLTARIAMFVIAAGILSYDAYLLIAWQR |
| Ga0137398_104392101 | 3300012683 | Vadose Zone Soil | MLFLKYLLLSAGIAMFVIAAGILAYDAYLLIAWQRRRLNLD |
| Ga0137395_101685891 | 3300012917 | Vadose Zone Soil | MLFLKYLLLSAGIAMFVIAAGILAYDAYLLIAWQRRRLNLDPAAGAPGLAPPI |
| Ga0137416_111690361 | 3300012927 | Vadose Zone Soil | MLFLKYLLLSAGIAMFVIAAGILAYDAYLLIAWQRRRLNLDPA |
| Ga0181521_100231321 | 3300014158 | Bog | MLWLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRSNLDPEAG |
| Ga0181523_100184851 | 3300014165 | Bog | MLFLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRLNSDPEVGAPGPT |
| Ga0181536_101607513 | 3300014638 | Bog | MLWLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRR |
| Ga0181525_108980331 | 3300014654 | Bog | MLLLKYLLLSAGIAMFVVAAGILSYDIYLLLRHQRQRL |
| Ga0181511_13304863 | 3300016702 | Peatland | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLITWQRRRL |
| Ga0187820_12066322 | 3300017924 | Freshwater Sediment | MLFVKYLLLGVGIAMFVVAAVILAYDAYLFLAYRRRLLHPV |
| Ga0187877_10558494 | 3300017931 | Peatland | MLWLKYLLLNAGIAMFVIAAGILTYDAYLLIAWQRR |
| Ga0187877_11038771 | 3300017931 | Peatland | MLLPKYLLLSAGIAMFAIAAGILTYDAYLLIAWQRRRLNFDSQA |
| Ga0187854_100498645 | 3300017938 | Peatland | MLLLKYLLLSAGIAMFVIAAGILTCDAYLFIAYQRRRLNLDPEAGAPGPAPGFPP |
| Ga0187819_106030883 | 3300017943 | Freshwater Sediment | MLWLKYLLLSAGIAMFAIVAGILTYDAYLLIAWQRRRSHLDPEAGA |
| Ga0187876_11848981 | 3300018003 | Peatland | MLLLKYLLLSTGIAMFAIAAGILTYDAYLFIAYQRRRLNLDPEAGAP |
| Ga0187865_10249631 | 3300018004 | Peatland | MLLLKYLLLSAGIAMFAIAAGILTYDAYLLIAWQRRRLNF |
| Ga0187888_12223633 | 3300018008 | Peatland | MLLLKYLLLSAGIAMFVIAAGILTCDAYLFIAYQRRRLNLDPEAGAPGP |
| Ga0187810_100697461 | 3300018012 | Freshwater Sediment | MLWLKYLLLSAGIAMFAIAAGILTCDAYLLIAWQRRRSHLDPEAGAPGLSPSPKI |
| Ga0187810_103171511 | 3300018012 | Freshwater Sediment | MLLLKYLLLYAGIAMFVIAAGILSYDAYLLIAWQRRRLHPDPEAGGLGPA |
| Ga0187873_13342291 | 3300018013 | Peatland | MLLLKYLLLSAGIAMFVIAAGILSYDAYLTIVWQRRRLNFRPEAGTPGLAP |
| Ga0187874_101811693 | 3300018019 | Peatland | MLLLKYLLLSAGIAMFVIAAGILSYDAYLTIVWQRRRLNFR |
| Ga0187874_104333163 | 3300018019 | Peatland | MLWLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRSNL |
| Ga0187882_13810731 | 3300018021 | Peatland | MLLLKYLLLSAGIAMFAIAAGILTYDAYLLIAWQRR |
| Ga0187882_14297761 | 3300018021 | Peatland | MLLLKYLLLYTGIAMFVIAAGILSYDAYLLIAWQRRRLHPD |
| Ga0187864_100527715 | 3300018022 | Peatland | MLLLKYFLLSAGIAMFVIAAGILTYDAYLLIAWQRRRSHLDPQAGAPGFSNSPSPTYS |
| Ga0187864_100736984 | 3300018022 | Peatland | MLLLKYLLLSAGIAMFAIATAILSYDAYLLLPGSADV |
| Ga0187889_101902653 | 3300018023 | Peatland | MLLLKHLLLSVGIAMFAIAAGILSYDAYLLIAWQRRRLNPDPETGA |
| Ga0187881_103767691 | 3300018024 | Peatland | MLWLKYLLLSAGIAMFVIAAGILTYDAYLLIAWQRRRSN |
| Ga0187857_101698521 | 3300018026 | Peatland | MLLLKYLLLSTGIAMFAIAAGILTYDAYLFIAYQRRRLNLDPEAGAPGP |
| Ga0187867_102185291 | 3300018033 | Peatland | MLLLKYLLLYTGIAMFVIAAGILSYDAYLLIAWQRRRLHPDPE |
| Ga0187883_100610054 | 3300018037 | Peatland | MLLLKYLLLSAGIAMFAIATAILSYDAYLFIAWQRRRLHPDPETAA |
| Ga0187871_103422083 | 3300018042 | Peatland | MLLLKYLLFYAGIAMFVIAAVILSYDAYLLIAWQRGRRHPDPEAGAPGPAPA |
| Ga0187871_104078043 | 3300018042 | Peatland | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLIAHQRRRLHADPAA |
| Ga0187859_104603033 | 3300018047 | Peatland | MLLLKYLLLSLGIAMFVIAAGILIYDAYLLIAWRRRRLHRDPEAGG |
| Ga0187784_107884203 | 3300018062 | Tropical Peatland | MLWLKYLLLSAGIAMFAIAAGILTYDAYLLIAWQR |
| Ga0187784_109484653 | 3300018062 | Tropical Peatland | MLWLKYLLLSAGIAMFAIAAGILTYDAYLLIAWQRRRSHLDPEAGAPGLS |
| Ga0187852_12615961 | 3300019082 | Peatland | MLLLKYLLLSTGIAMFAIAAGILTCDAYLFIAYQRRRLNLDPEA |
| Ga0187852_14257343 | 3300019082 | Peatland | MLWLKYLLLSAGTAMFAIAAAILTCDAYLLIVWQRR |
| Ga0182031_14118752 | 3300019787 | Bog | LLLSVGIAMFAIAAGILSYDAYLLIAWQRRRLNPEP |
| Ga0210399_100252608 | 3300020581 | Soil | MLMLKYLLLTAGIAMFVVAAGILTYDAYLLIAYQRRRLNLDPAAGAPGP |
| Ga0210401_102582141 | 3300020583 | Soil | MLLLKYLLLSAGIAMFAISAGILTYDAYLLIAYQRRRQHPDPT |
| Ga0210406_112331821 | 3300021168 | Soil | MLMLKYLLLTAGIAMFVVAAGILTYDAYLLIAYQRRRLNLDPA |
| Ga0210385_112314742 | 3300021402 | Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIVWQRRRLHPDPEAAALDPGSA |
| Ga0210391_104661363 | 3300021433 | Soil | MLLLKYLLLSAGIAMFVIAAGILTYDAYLLVAYQRRCLHADP |
| Ga0224541_10117233 | 3300022521 | Soil | MLLLKYLLLYAGIAMFVIAAGFLSYDAYLLIMWQRRRLH |
| Ga0224544_10716021 | 3300023250 | Soil | MLLLKYLLISAGIAMFVIAAGILSYDACLLVAWQRRRL |
| Ga0224522_10535731 | 3300024240 | Soil | MLLLKYVLLSAGIAMFVIAAAILTCDAYWFLAGRRRLNFDPERGAPGVASA |
| Ga0209840_10315293 | 3300026223 | Soil | MLLLKYFLLSAGIAMFAIAAGILTYDAYLLIAYQRRRLNFDPE |
| Ga0209839_100865473 | 3300026294 | Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIVYQRRRMNLEP |
| Ga0257149_10448132 | 3300026355 | Soil | VLVLKYLLLIAGVAMFVIAAGILTYDAYLLIAWQRRRLNLDPA |
| Ga0209648_101274521 | 3300026551 | Grasslands Soil | MLVLKYLLLIAGVAMFVIAAGILTYDAYLLIAWQRRRLNLDAAAGAPGPA |
| Ga0209220_10685454 | 3300027587 | Forest Soil | MLLLKYLLLTAGIAMFVIAAGILTYDACLLIAWQRRRLNLDPAAGAPGPAPA |
| Ga0209420_11374722 | 3300027648 | Forest Soil | MLSLKYLLLSAGVAMFVIAAGILTYDAWLLIAWQRKRLHPDPEAGAPGIAPAVR |
| Ga0209009_10358081 | 3300027667 | Forest Soil | MLFLKYLLLTAGIAMFVIAAGILTYDAYLLIAWQRRRLNLDPAAGAPGP |
| Ga0209447_101616851 | 3300027701 | Bog Forest Soil | MLLLKYLLLSVGIAMFVIAAGILSYDAYLFLAWQRKRLHPD |
| Ga0209038_101661491 | 3300027737 | Bog Forest Soil | MLLLKYLLLSAGIAMFVIAAGILAYDAYLLFAWQRKRLHPEPEGGALGISPPI |
| Ga0209656_104730382 | 3300027812 | Bog Forest Soil | MLLLKYLLLSAGIAMFVIAAGILAYDAYLLIAYQR |
| Ga0209039_102074581 | 3300027825 | Bog Forest Soil | MPSLNHLLLGTGIAMFAIAAAILTCDAYLLISDHRGRWNFNPETGTPGP |
| Ga0209274_103931881 | 3300027853 | Soil | MLLLKYLLVSAGIAMFVIAAGILTYDAYLLLAWQRRRLHPEPEAGAAALPLGFAPKI |
| Ga0209275_107744793 | 3300027884 | Soil | MLLLKYLLLYAGIAMFVVAAGILSYDAYLLIMWQRR |
| Ga0209380_103114541 | 3300027889 | Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIVWQRRRLHPDPEA |
| Ga0302222_101764323 | 3300028798 | Palsa | MLLLKYLLLYAGIAMFVIAAGFLSYDAYLLIMWQRRRLHPDPEAGAHEGSSLGPAPA |
| Ga0302304_100310774 | 3300029993 | Palsa | MLLLKYLLLYAGIAMFVIAAGILSYDAYLLIMWQRRRLHPDPEAGAHEGS |
| Ga0302172_101207731 | 3300030003 | Fen | MLLLKYLLLGAGIAMFAVAAGILIVDAYLFIAYKRER |
| Ga0302175_101111363 | 3300030014 | Fen | MLLLKYLLLGAGIAMFAVAAGILIVDAYLFIAYKRERL |
| Ga0311372_129987632 | 3300030520 | Palsa | MLLLKYLLVSAGIAMFVMAAGILSYDAYLLIAWQRRRLHPDPEAGTPAIPLGIAPAVR |
| Ga0311356_114996781 | 3300030617 | Palsa | MLLLKYLLLYVGISMFVIAAGILSYDAYLLIAWQRRR |
| Ga0302180_103307261 | 3300031028 | Palsa | MLLLKYLLLYVGISMFVIAAGILSYDAYLLIAWQRRRLDPD |
| Ga0302324_1028069761 | 3300031236 | Palsa | MLLLKYLLLSLGIAMFVIAAGILIYDAYLLMAWQRRRLHPDPEAGAP |
| Ga0302324_1030869052 | 3300031236 | Palsa | MLLLKYLLLSAGIAMFVIAAGILIYDAYLFIMYQRRRLNPDPDAGVAGLVTVSIPI |
| Ga0302321_1011415223 | 3300031726 | Fen | MLLKCWLLSAGIAMFIIAAGIFTYDVFLLIAYQRRG |
| Ga0311301_108578181 | 3300032160 | Peatlands Soil | MLWLKYLLLGAGIAMFVIAAGILTYDAYLLIAWQRRR |
| Ga0315281_115460301 | 3300032163 | Sediment | MLLLKYLLVSAGIMMFVIAAGILIYDLYLLLAYRRSR |
| Ga0335078_118579661 | 3300032805 | Soil | MLFVKYLLLSAGIGMFVIAAAILGYDSYLLISYRRRLFAGGAT |
| Ga0316624_115264131 | 3300033486 | Soil | MLLLKYLLLSAGIAMFVIAAGILSYDAYLLIAWQR |
| ⦗Top⦘ |