| Basic Information | |
|---|---|
| Family ID | F090956 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MNEFNWGPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 78.70 % |
| % of genes near scaffold ends (potentially truncated) | 22.22 % |
| % of genes from short scaffolds (< 2000 bps) | 76.85 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (55.556 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (50.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (95.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00542 | Ribosomal_L12 | 3.70 |
| PF14743 | DNA_ligase_OB_2 | 1.85 |
| PF08406 | CbbQ_C | 1.85 |
| PF14090 | HTH_39 | 0.93 |
| PF13671 | AAA_33 | 0.93 |
| PF00596 | Aldolase_II | 0.93 |
| PF07460 | NUMOD3 | 0.93 |
| PF10902 | WYL_2 | 0.93 |
| PF06941 | NT5C | 0.93 |
| PF10431 | ClpB_D2-small | 0.93 |
| PF12112 | DUF3579 | 0.93 |
| PF13392 | HNH_3 | 0.93 |
| PF09825 | BPL_N | 0.93 |
| PF10518 | TAT_signal | 0.93 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.93 |
| PF01467 | CTP_transf_like | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0222 | Ribosomal protein L7/L12 | Translation, ribosomal structure and biogenesis [J] | 3.70 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 1.85 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.81 % |
| Unclassified | root | N/A | 35.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c035124 | Not Available | 676 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c009829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1057435 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1062393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10031598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3719 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10036960 | All Organisms → Viruses → Predicted Viral | 3267 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10043356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2868 | Open in IMG/M |
| 3300001838|RCM33_1014616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia multivorans | 593 | Open in IMG/M |
| 3300004686|Ga0065173_1033359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300004770|Ga0007804_1184899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300006071|Ga0007876_1031070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1477 | Open in IMG/M |
| 3300006071|Ga0007876_1090872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300006071|Ga0007876_1161858 | Not Available | 554 | Open in IMG/M |
| 3300006071|Ga0007876_1178166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300006072|Ga0007881_1024052 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300006072|Ga0007881_1119267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300006100|Ga0007806_1063598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300006101|Ga0007810_1018973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1601 | Open in IMG/M |
| 3300006101|Ga0007810_1094062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300006103|Ga0007813_1032089 | Not Available | 1161 | Open in IMG/M |
| 3300006103|Ga0007813_1103596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300006103|Ga0007813_1110379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300006104|Ga0007882_10256011 | Not Available | 575 | Open in IMG/M |
| 3300006109|Ga0007870_1058401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300006115|Ga0007816_1097373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300006116|Ga0007807_1091817 | Not Available | 561 | Open in IMG/M |
| 3300006116|Ga0007807_1096487 | Not Available | 544 | Open in IMG/M |
| 3300006118|Ga0007859_1110416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300006119|Ga0007866_1000792 | Not Available | 9157 | Open in IMG/M |
| 3300006119|Ga0007866_1036071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
| 3300006119|Ga0007866_1083810 | Not Available | 588 | Open in IMG/M |
| 3300006120|Ga0007867_1019998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1539 | Open in IMG/M |
| 3300006120|Ga0007867_1069534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300006121|Ga0007824_1001996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5057 | Open in IMG/M |
| 3300006127|Ga0007805_1091696 | Not Available | 656 | Open in IMG/M |
| 3300012701|Ga0157562_1131133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300013093|Ga0164296_1062497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1707 | Open in IMG/M |
| 3300013093|Ga0164296_1091421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1298 | Open in IMG/M |
| 3300013093|Ga0164296_1097245 | Not Available | 1244 | Open in IMG/M |
| 3300013093|Ga0164296_1227301 | Not Available | 712 | Open in IMG/M |
| 3300013093|Ga0164296_1231274 | Not Available | 705 | Open in IMG/M |
| 3300013093|Ga0164296_1347965 | Not Available | 551 | Open in IMG/M |
| 3300013093|Ga0164296_1410059 | Not Available | 500 | Open in IMG/M |
| 3300013094|Ga0164297_10227084 | Not Available | 720 | Open in IMG/M |
| 3300013094|Ga0164297_10334407 | Not Available | 578 | Open in IMG/M |
| 3300020710|Ga0214198_1020528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300020716|Ga0214207_1000462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12260 | Open in IMG/M |
| 3300020726|Ga0214220_1006523 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300020726|Ga0214220_1008391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1806 | Open in IMG/M |
| 3300020730|Ga0214216_1011222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
| 3300020731|Ga0214170_1060059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300021121|Ga0214173_101519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3047 | Open in IMG/M |
| 3300021124|Ga0214199_1007047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
| 3300021131|Ga0214206_1029089 | Not Available | 643 | Open in IMG/M |
| 3300021133|Ga0214175_1014981 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300021133|Ga0214175_1030259 | Not Available | 673 | Open in IMG/M |
| 3300021135|Ga0214247_1003303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5014 | Open in IMG/M |
| 3300021137|Ga0214165_1014119 | All Organisms → Viruses → Predicted Viral | 2247 | Open in IMG/M |
| 3300021138|Ga0214164_1059234 | Not Available | 806 | Open in IMG/M |
| 3300021138|Ga0214164_1072690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300021139|Ga0214166_1000078 | Not Available | 49543 | Open in IMG/M |
| 3300021139|Ga0214166_1013847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
| 3300021139|Ga0214166_1115209 | Not Available | 516 | Open in IMG/M |
| 3300021142|Ga0214192_1039634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300021142|Ga0214192_1067024 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300021142|Ga0214192_1069863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
| 3300022594|Ga0236340_1017493 | Not Available | 1996 | Open in IMG/M |
| 3300022602|Ga0248169_100379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 71720 | Open in IMG/M |
| 3300022602|Ga0248169_105147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13230 | Open in IMG/M |
| 3300022602|Ga0248169_111044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6939 | Open in IMG/M |
| 3300022602|Ga0248169_113192 | Not Available | 5950 | Open in IMG/M |
| 3300022602|Ga0248169_139444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2314 | Open in IMG/M |
| 3300023311|Ga0256681_10146175 | Not Available | 503 | Open in IMG/M |
| 3300023311|Ga0256681_12319642 | Not Available | 536 | Open in IMG/M |
| 3300024351|Ga0255141_1035654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 744 | Open in IMG/M |
| 3300025338|Ga0208501_108693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300025346|Ga0208737_1009689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300025357|Ga0208383_1000008 | Not Available | 63175 | Open in IMG/M |
| 3300025358|Ga0208504_1018787 | Not Available | 943 | Open in IMG/M |
| 3300025358|Ga0208504_1043967 | Not Available | 539 | Open in IMG/M |
| 3300025369|Ga0208382_1016615 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300025369|Ga0208382_1035382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300025372|Ga0207957_1029096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300025379|Ga0208738_1004167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2797 | Open in IMG/M |
| 3300025379|Ga0208738_1020267 | Not Available | 1063 | Open in IMG/M |
| 3300025379|Ga0208738_1030584 | Not Available | 822 | Open in IMG/M |
| 3300025379|Ga0208738_1051488 | Not Available | 590 | Open in IMG/M |
| 3300025382|Ga0208256_1019976 | Not Available | 1005 | Open in IMG/M |
| 3300025383|Ga0208250_1015040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
| 3300025383|Ga0208250_1032888 | Not Available | 810 | Open in IMG/M |
| 3300025387|Ga0207959_1003448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3230 | Open in IMG/M |
| 3300025388|Ga0208503_1004182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1958 | Open in IMG/M |
| 3300025391|Ga0208740_1000042 | Not Available | 53205 | Open in IMG/M |
| 3300025392|Ga0208380_1055721 | Not Available | 564 | Open in IMG/M |
| 3300025396|Ga0208874_1000054 | Not Available | 39267 | Open in IMG/M |
| 3300025401|Ga0207955_1005717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2728 | Open in IMG/M |
| 3300025401|Ga0207955_1015534 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300025401|Ga0207955_1070752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300025410|Ga0208875_1077948 | Not Available | 502 | Open in IMG/M |
| 3300025421|Ga0207958_1048938 | Not Available | 618 | Open in IMG/M |
| 3300025598|Ga0208379_1108066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300025598|Ga0208379_1111826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300025789|Ga0208499_1069545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300027896|Ga0209777_11207797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300031759|Ga0316219_1285414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300031884|Ga0316220_1010200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5548 | Open in IMG/M |
| 3300032562|Ga0316226_1029338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3068 | Open in IMG/M |
| 3300032605|Ga0316232_1281837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 50.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 18.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 11.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.78% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.93% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300012701 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES061 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020730 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300025338 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE09Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025346 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025388 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0351243 | 3300000176 | Freshwater | MNEFNWGPIIGTVIAIAGMMFALVLGYIIGYSDAKERK* |
| TB18AUG2009E_0098295 | 3300000203 | Freshwater | MNEFDWGPVIGTAIAIAGMLFTLALGYVIGYSDAREGK* |
| TBL_comb48_EPIDRAFT_10574353 | 3300000439 | Freshwater | MNEFNLGPIISTAIAIAGMLFALVMGYLMGYNDAKDGR* |
| TBL_comb48_EPIDRAFT_10623933 | 3300000439 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGR* |
| TBL_comb47_HYPODRAFT_100315983 | 3300000553 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR* |
| TBL_comb47_HYPODRAFT_100369603 | 3300000553 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALMMGYLIGYNDAKEGR* |
| TBL_comb47_HYPODRAFT_100433565 | 3300000553 | Freshwater | MNKFDWGPVIGTVIAIAGMMFALVMGYLIGYNDAKEGK* |
| RCM33_10146163 | 3300001838 | Marine Plankton | MNWGPIVGMIIAVGGMVFAFVMGYYVGYCDAKDGR* |
| Ga0065173_10333592 | 3300004686 | Freshwater | LVMKEFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAGK* |
| Ga0007804_11848991 | 3300004770 | Freshwater | MKEFDWGPVIGTVIAIAGMLFALVLGYIIGYSDAKEGK*T |
| Ga0007876_10310706 | 3300006071 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR* |
| Ga0007876_10908723 | 3300006071 | Freshwater | MNKFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAGR* |
| Ga0007876_11618581 | 3300006071 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKDDK* |
| Ga0007876_11781662 | 3300006071 | Freshwater | MNEFNWGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR* |
| Ga0007881_10240522 | 3300006072 | Freshwater | MNEFNWAPIIGTAIAIAGMMFALVMGYLMGYNDAKDGR* |
| Ga0007881_11192672 | 3300006072 | Freshwater | MNKFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKARK* |
| Ga0007806_10635983 | 3300006100 | Freshwater | MNKFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKAGK* |
| Ga0007810_10189733 | 3300006101 | Freshwater | MNEFNWESIIGTAIAIAGMLFALVMGYLIGYNDAKEGR* |
| Ga0007810_10940622 | 3300006101 | Freshwater | MKEFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAGK* |
| Ga0007813_10320895 | 3300006103 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGR* |
| Ga0007813_11035963 | 3300006103 | Freshwater | MNEFNWAPIVGTAIAIAGMLFALVMGYLIGYNDAKEGK* |
| Ga0007813_11103793 | 3300006103 | Freshwater | MNEFSWGPIIGTAVAIAGMLFALVMGYLIGYSDAKEGK* |
| Ga0007882_102560113 | 3300006104 | Freshwater | IKRMNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK* |
| Ga0007870_10584012 | 3300006109 | Freshwater | MNEFNWDPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR* |
| Ga0007816_10973731 | 3300006115 | Freshwater | SWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK* |
| Ga0007807_10918171 | 3300006116 | Freshwater | LPLGKRTGMNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR* |
| Ga0007807_10964872 | 3300006116 | Freshwater | MNKFDWGPVIGTAIAIAGMMFTLVMGYLIGYNDAKAGR* |
| Ga0007859_11104162 | 3300006118 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR* |
| Ga0007866_100079217 | 3300006119 | Freshwater | MNEFSWGPIIGTAIAIAGMMLALVLGYIIGYSDAKEGK* |
| Ga0007866_10360714 | 3300006119 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLMGYNDAKEGR* |
| Ga0007866_10838103 | 3300006119 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYSDAKEGK* |
| Ga0007867_10199984 | 3300006120 | Freshwater | MNEFNWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK* |
| Ga0007867_10695343 | 3300006120 | Freshwater | MNEFNWGPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR* |
| Ga0007824_10019963 | 3300006121 | Freshwater | MNEFNWAPVIGTIIAIAGMAFALVMGYLIGYNDAKDGK* |
| Ga0007805_10916961 | 3300006127 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR* |
| Ga0157562_11311333 | 3300012701 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK* |
| Ga0164296_10624975 | 3300013093 | Freshwater | MNKFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKAGR* |
| Ga0164296_10914216 | 3300013093 | Freshwater | MNEFNLGPIIGTAIAIAGMMFALVMGYLMGYNDAKDGR* |
| Ga0164296_10972454 | 3300013093 | Freshwater | MNKFDWGPVIGTAIAIAAMMFALVMGYLIGYNNAKAGK* |
| Ga0164296_12273011 | 3300013093 | Freshwater | MNEFIWGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR* |
| Ga0164296_12312743 | 3300013093 | Freshwater | GKRTGMNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKEGR* |
| Ga0164296_13479653 | 3300013093 | Freshwater | MNEFNWGPIIGAAIAIAGMMFALVLGYIIGYSDAKERK* |
| Ga0164296_14100593 | 3300013093 | Freshwater | MNKFDWGPVIGTVIAIAGMLFALVMGYLIGYNDAKDGR* |
| Ga0164297_102270842 | 3300013094 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLMGYNDAKEGR* |
| Ga0164297_103344072 | 3300013094 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLMGYTDAKDGR* |
| Ga0214198_10205283 | 3300020710 | Freshwater | MNEFNLGPIISTAIAIAGMLFALVMGYLMGYNDAKDGR |
| Ga0214207_10004629 | 3300020716 | Freshwater | MNEFNWGPIIGTVIAIAGMMFALVLGYIIGYSDAKERK |
| Ga0214220_10065237 | 3300020726 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR |
| Ga0214220_10083913 | 3300020726 | Freshwater | MNKFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAGR |
| Ga0214216_10112224 | 3300020730 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR |
| Ga0214170_10600593 | 3300020731 | Freshwater | MNKFDWGPVIGTVIAIAGMMFALVMGYLIGYNDAKEGK |
| Ga0214173_1015193 | 3300021121 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGR |
| Ga0214199_10070474 | 3300021124 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0214206_10290892 | 3300021131 | Freshwater | MNEFSWEPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0214175_10149814 | 3300021133 | Freshwater | MNEFNWAPIVGTVIAVAGMLFALVMGYLMGYNDAKDGR |
| Ga0214175_10302593 | 3300021133 | Freshwater | MNEFNWGPIIGTVIAIAGMMFALVLGYIIGYSDAKDRK |
| Ga0214247_100330310 | 3300021135 | Freshwater | MNKFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKAGR |
| Ga0214165_10141192 | 3300021137 | Freshwater | MNKFDWAPVIGTAIAIAGMMFALVMGYLIGYNDAKAGR |
| Ga0214164_10592344 | 3300021138 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0214164_10726901 | 3300021138 | Freshwater | HRIFIMNKFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKAGR |
| Ga0214166_100007870 | 3300021139 | Freshwater | MNEFSWGPIIGTAIAIAGMMLALVLGYIIGYSDAKEGK |
| Ga0214166_10138475 | 3300021139 | Freshwater | MNEFDWGPVIGTAIAIAGMLFTLALGYVIGYSDAREGK |
| Ga0214166_11152093 | 3300021139 | Freshwater | LPLGKRTGMNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGR |
| Ga0214192_10396342 | 3300021142 | Freshwater | MNEFNWGPIIGAAIAIAGMMFALVLGYIIGYSDAKERK |
| Ga0214192_10670241 | 3300021142 | Freshwater | NLPLGKRTGMNEFNLGPIIGTAIAIVGMLFALVMGYLMGYNDAKDGR |
| Ga0214192_10698631 | 3300021142 | Freshwater | TLLYVRIKRMNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0236340_10174936 | 3300022594 | Freshwater | VSANWAPFIGAAIAIAGMLFALVLGYLIGYNDAKAGR |
| Ga0248169_10037971 | 3300022602 | Freshwater | MNEFNLGPMIGTAIAIAGMMFALVMGYLIGYNDAKDGR |
| Ga0248169_10514737 | 3300022602 | Freshwater | MNKFDWGPVIGTAIAIAAMMFALVMGYLIGYNNAKAGK |
| Ga0248169_11104421 | 3300022602 | Freshwater | LGKRTGMNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKEGR |
| Ga0248169_1131924 | 3300022602 | Freshwater | MNEFNLGPIIGTAIAIVGMLFALVMGYLMGYNDAKDGR |
| Ga0248169_1394442 | 3300022602 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLIGYNDAKVGR |
| Ga0256681_101461751 | 3300023311 | Freshwater | MNKFDWGPVIGTAIAVAGMMFALVMGYLIGYNDAKAGK |
| Ga0256681_123196421 | 3300023311 | Freshwater | MSYGPIVGAVIAIAGMAFALVIGYLIGYNDAKEGR |
| Ga0255141_10356543 | 3300024351 | Freshwater | MSWGPIVGMIIAIAGMLFALVIGYLIGYNDAKAGR |
| Ga0208501_1086931 | 3300025338 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKEGRXTN |
| Ga0208737_10096892 | 3300025346 | Freshwater | MNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKEGR |
| Ga0208383_100000869 | 3300025357 | Freshwater | MNEFNWDPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR |
| Ga0208504_10187874 | 3300025358 | Freshwater | MNEFNWAPVIGTIIAIAGMAFALVMGYLIGYNDAKDGK |
| Ga0208504_10439671 | 3300025358 | Freshwater | MKEFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAK |
| Ga0208382_10166153 | 3300025369 | Freshwater | MNEFIWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0208382_10353823 | 3300025369 | Freshwater | MNEFNWGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR |
| Ga0207957_10290963 | 3300025372 | Freshwater | MNKFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKEGK |
| Ga0208738_10041671 | 3300025379 | Freshwater | FNWAPIVGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0208738_10202675 | 3300025379 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKDDK |
| Ga0208738_10305841 | 3300025379 | Freshwater | KRTGMNEFNLGPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR |
| Ga0208738_10514883 | 3300025379 | Freshwater | GKRTGMNEFNLGPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR |
| Ga0208256_10199764 | 3300025382 | Freshwater | MNEFNWGPIISTAIAIAGMLFALVMGYLMGYNDAKDGR |
| Ga0208250_10150403 | 3300025383 | Freshwater | MNKFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKAGK |
| Ga0208250_10328881 | 3300025383 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAK |
| Ga0207959_10034486 | 3300025387 | Freshwater | MNEFNLGTIIGTAIAIAGMLFALVMGYLMGYNDAKEGK |
| Ga0208503_10041826 | 3300025388 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLMGYNDAKEGR |
| Ga0208740_100004225 | 3300025391 | Freshwater | MNEFNWESIIGTAIAIAGMLFALVMGYLIGYNDAKEGR |
| Ga0208380_10557213 | 3300025392 | Freshwater | KFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKARK |
| Ga0208874_100005412 | 3300025396 | Freshwater | MKEFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAGK |
| Ga0207955_10057171 | 3300025401 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKD |
| Ga0207955_10155343 | 3300025401 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLIGYNDAKDGR |
| Ga0207955_10707522 | 3300025401 | Freshwater | MNEFNWAPIVGTAIAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0208875_10779482 | 3300025410 | Freshwater | MNEFSWGPIIGTAVAIAGMLFALVMGYLIGYNDAKEGK |
| Ga0207958_10489381 | 3300025421 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALVMGYLIGYNDAKEG |
| Ga0208379_11080663 | 3300025598 | Freshwater | MNKFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAG |
| Ga0208379_11118263 | 3300025598 | Freshwater | RSHRIFTMNKFDWGPVIGTAIAIAGMMFALVMGYLIGYNDAKAGR |
| Ga0208499_10695452 | 3300025789 | Freshwater | MNEFNWAPIIGTAIAIAGMMFALVMGYLMGYNDAKDGR |
| Ga0209777_112077973 | 3300027896 | Freshwater Lake Sediment | KFDWGAVIGTAIAVAGMMFALVMGYLIGYNDAKAGR |
| Ga0316219_12854141 | 3300031759 | Freshwater | FIKAFWSYRMNEFSWGPIIGTAIAIAGMLFALMMGYLIGYNDAKEGR |
| Ga0316220_10102008 | 3300031884 | Freshwater | MNKFDWGPVIGTVIAIAGMLFALVMGYLIGYNDAKDGR |
| Ga0316226_10293388 | 3300032562 | Freshwater | MNEFNWAPIIGTAIAIAGMLFALVMGYLMGYNDAKDGR |
| Ga0316232_12818372 | 3300032605 | Freshwater | MNEFSWGPIIGTAIAIAGMLFALMMGYLIGYNDAKEGR |
| ⦗Top⦘ |