Metagenome Family F090935

Overview

Basic Information

• Family ID: F090935
• Family Type: Metagenome
• Number of Sequences: 108
• Average Sequence Length: 46 residues
• Representative Sequence: WSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA
• Number of Associated Samples: 104
• Number of Associated Scaffolds: 108

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.93 %
• % of genes near scaffold ends (potentially truncated): 95.37 %
• % of genes from short scaffolds (< 2000 bps): 91.67 %
• Associated GOLD sequencing projects: 99
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (50.000 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.259 % of family members)
• Environment Ontology (ENVO): Unclassified (25.926 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (42.593 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 31.51%
  β-sheet: 12.33%
  Coil/Unstructured: 56.16%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF00487	FA_desaturase	7.41
PF00072	Response_reg	2.78
PF00211	Guanylate_cyc	2.78
PF07369	DUF1488	1.85
PF13439	Glyco_transf_4	1.85
PF13581	HATPase_c_2	1.85
PF07536	HWE_HK	1.85
PF04116	FA_hydroxylase	1.85
PF00689	Cation_ATPase_C	0.93
PF03330	DPBB_1	0.93
PF13505	OMP_b-brl	0.93
PF01192	RNA_pol_Rpb6	0.93
PF13417	GST_N_3	0.93
PF01553	Acyltransferase	0.93
PF00313	CSD	0.93
PF08924	DUF1906	0.93
PF00528	BPD_transp_1	0.93
PF16822	ALGX	0.93
PF03544	TonB_C	0.93
PF00027	cNMP_binding	0.93
PF02472	ExbD	0.93
PF13432	TPR_16	0.93
PF00472	RF-1	0.93
PF03401	TctC	0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	7.41
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	7.41
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	2.78
COG3000	Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily	Lipid transport and metabolism [I]	1.85
COG3920	Two-component sensor histidine kinase, HisKA and HATPase domains	Signal transduction mechanisms [T]	1.85
COG4251	Bacteriophytochrome (light-regulated signal transduction histidine kinase)	Signal transduction mechanisms [T]	1.85
COG0216	Protein chain release factor RF1	Translation, ribosomal structure and biogenesis [J]	0.93
COG0474	Magnesium-transporting ATPase (P-type)	Inorganic ion transport and metabolism [P]	0.93
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.93
COG0848	Biopolymer transport protein ExbD	Intracellular trafficking, secretion, and vesicular transport [U]	0.93
COG1186	Protein chain release factor PrfB	Translation, ribosomal structure and biogenesis [J]	0.93
COG1758	DNA-directed RNA polymerase, subunit K/omega	Transcription [K]	0.93
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.93

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.00 %
Unclassified	root	N/A	50.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.00 %
Unclassified	root	N/A	50.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	47.22 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.78 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	43.52 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.78 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	39.81 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2.78 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.93 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21.30 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	12.04 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	2.78 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.93 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8.33 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2.78 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	1.85 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.93 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.93 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7.41 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.78 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1.85 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.93 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.78 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	2.78 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	1.85 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.78 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.78 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.78 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	2.78 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	2.78 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	2.78 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Caryophyllales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Amaranthaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
lamiids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solanales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solanaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solanoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solaneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solanum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solanum subgen. Lycopersicon	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	12.04 %
Bosea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	1.85 %
Bradyrhizobium sp. 174	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	1.85 %
Solanum lycopersicum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon → Solanum lycopersicum	0.93 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.93 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	0.93 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.93 %
Bradyrhizobium sp. Leo121	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	0.93 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.93 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.93 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459005|F1BAP7Q02H8GT7	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554
2199352025|deepsgr__Contig_1001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4171
3300000550|F24TB_10428194	Not Available	523
3300000890|JGI11643J12802_11598793	Not Available	526
3300004062|Ga0055500_10025606	All Organisms → cellular organisms → Bacteria → Proteobacteria	1075
3300004633|Ga0066395_10081135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1520
3300004643|Ga0062591_101867535	Not Available	615
3300005093|Ga0062594_103333535	Not Available	505
3300005163|Ga0066823_10152840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	512
3300005185|Ga0066811_1019175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	573
3300005218|Ga0068996_10009421	Not Available	1328
3300005347|Ga0070668_101608014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	595
3300005440|Ga0070705_101637973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	542
3300005445|Ga0070708_102051799	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea	529
3300005457|Ga0070662_101808254	Not Available	528
3300005563|Ga0068855_101281296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	759
3300005713|Ga0066905_101373145	Not Available	638
3300005764|Ga0066903_100568622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1951
3300005764|Ga0066903_105189163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	689
3300005843|Ga0068860_100994006	All Organisms → cellular organisms → Bacteria	857
3300005844|Ga0068862_101988830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	592
3300006047|Ga0075024_100802089	Not Available	527
3300006048|Ga0075363_100591401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	664
3300006049|Ga0075417_10063516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1621
3300006059|Ga0075017_101573722	Not Available	518
3300006086|Ga0075019_10918950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121	562
3300006162|Ga0075030_100712721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	794
3300006163|Ga0070715_10183387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1051
3300006174|Ga0075014_100199529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1008
3300006638|Ga0075522_10189958	Not Available	1043
3300006642|Ga0075521_10375696	Not Available	690
3300006795|Ga0075520_1218935	All Organisms → cellular organisms → Bacteria	801
3300006846|Ga0075430_100143895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1985
3300006854|Ga0075425_100553464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1324
3300006854|Ga0075425_100841486	Not Available	1050
3300006854|Ga0075425_102541689	Not Available	566
3300006871|Ga0075434_102528062	Not Available	514
3300006903|Ga0075426_10626245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174	804
3300009011|Ga0105251_10114069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	1229
3300009092|Ga0105250_10184932	Not Available	875
3300009098|Ga0105245_12735620	Not Available	546
3300009148|Ga0105243_11372637	Not Available	726
3300009162|Ga0075423_10192275	Not Available	2141
3300009174|Ga0105241_10392177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1216
3300009545|Ga0105237_10138816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2425
3300009649|Ga0105855_1103763	All Organisms → cellular organisms → Bacteria → Proteobacteria	802
3300010360|Ga0126372_12886465	Not Available	532
3300010371|Ga0134125_11435101	Not Available	752
3300010373|Ga0134128_11397142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	771
3300010396|Ga0134126_10514312	Not Available	1378
3300010401|Ga0134121_10385238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1263
3300012010|Ga0120118_1013441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	2306
3300012199|Ga0137383_11344536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	507
3300012359|Ga0137385_11640789	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	507
3300012948|Ga0126375_11013806	Not Available	677
3300012989|Ga0164305_11116060	All Organisms → cellular organisms → Bacteria	678
3300013772|Ga0120158_10243998	Not Available	903
3300013772|Ga0120158_10249149	Not Available	890
3300014058|Ga0120149_1170926	Not Available	603
3300014497|Ga0182008_10321735	Not Available	814
3300015374|Ga0132255_102888545	Not Available	734
3300016357|Ga0182032_10826320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	784
3300017999|Ga0187767_10010797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1788
3300018029|Ga0187787_10485080	Not Available	504
3300018031|Ga0184634_10365006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662
3300019869|Ga0193705_1084548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606
3300019875|Ga0193701_1050721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	840
3300025457|Ga0208850_1032237	Not Available	899
3300025509|Ga0208848_1123591	Not Available	508
3300025650|Ga0209385_1007254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4683
3300025711|Ga0207696_1126038	Not Available	689
3300025854|Ga0209176_10003131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	2967
3300025878|Ga0209584_10256446	Not Available	670
3300025911|Ga0207654_10252058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1184
3300025926|Ga0207659_11620375	Not Available	552
3300025941|Ga0207711_12070806	Not Available	512
3300025944|Ga0207661_10232587	Not Available	1633
3300025972|Ga0207668_11435931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	622
3300026035|Ga0207703_11907934	Not Available	570
3300026089|Ga0207648_10895859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	829
3300026116|Ga0207674_10003170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20247
3300026221|Ga0209848_1071446	Not Available	615
3300026294|Ga0209839_10108861	Not Available	941
3300026802|Ga0207511_104012	Not Available	696
3300027252|Ga0209973_1032994	Not Available	737
3300027429|Ga0207616_101801	Not Available	628
3300027775|Ga0209177_10149876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	790
3300027880|Ga0209481_10028006	Not Available	2534
3300027909|Ga0209382_10405263	All Organisms → cellular organisms → Bacteria → Proteobacteria	1518
3300028715|Ga0307313_10276244	Not Available	523
3300028719|Ga0307301_10179674	Not Available	685
3300028768|Ga0307280_10104655	Not Available	944
3300028784|Ga0307282_10568103	Not Available	550
3300028875|Ga0307289_10393546	Not Available	570
3300031538|Ga0310888_10000687	All Organisms → cellular organisms → Bacteria	8775
3300031562|Ga0310886_10925348	Not Available	555
3300031716|Ga0310813_11825817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	571
3300031726|Ga0302321_102786487	Not Available	571
3300031740|Ga0307468_101335562	Not Available	655
3300031744|Ga0306918_10618604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	849
3300031858|Ga0310892_10863938	Not Available	631
3300031913|Ga0310891_10251196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	611
3300031941|Ga0310912_10884190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	688
3300032003|Ga0310897_10722040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	501
3300032075|Ga0310890_10862527	Not Available	720
3300032122|Ga0310895_10575215	Not Available	575
3300032205|Ga0307472_102448104	Not Available	530
3300032722|Ga0316231_1367948	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon → Solanum lycopersicum	543

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	69.44%
Host-Associated	Host-Associated	30.56%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.11%
Plants	Host-Associated → Plants	30.56%
Aquatic	Environmental → Aquatic	8.33%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	60.19%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.22%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.41%
Sediment	Environmental → Aquatic → Sediment	5.56%
Marine	Environmental → Aquatic → Marine	1.85%
Freshwater	Environmental → Aquatic → Freshwater	0.93%
Peat	Environmental → Terrestrial → Peat	0.93%
Roots	Host-Associated → Plants → Roots	0.93%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	47.22%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.52%
Loam	Environmental → Terrestrial → Soil → Loam	8.33%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.56%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.63%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.70%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.85%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.93%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.93%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.93%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.52%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	11.11%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.63%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.63%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.70%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.70%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.78%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.85%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.93%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.93%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.93%

Habitat

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.33%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	7.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.48%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.63%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.70%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	3.70%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.70%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.78%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.78%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.85%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.85%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.85%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	1.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.85%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	0.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.93%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.93%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.93%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.93%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005163	Soil and rhizosphere microbial communities from Laval, Canada - mgHMB	Environmental
3300005185	Soil and rhizosphere microbial communities from Laval, Canada - mgHPB	Environmental
3300005218	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental
3300006642	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D	Environmental
3300006795	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B	Environmental
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009649	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300012010	Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M	Environmental
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental
3300014058	Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M	Environmental
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental
3300017999	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG	Environmental
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental
3300019869	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2	Environmental
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental
3300025457	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)	Environmental
3300025509	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)	Environmental
3300025650	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)	Environmental
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated
3300025854	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)	Environmental
3300025878	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300026221	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)	Environmental
3300026294	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)	Environmental
3300026802	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-C (SPAdes)	Environmental
3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)	Host-Associated
3300027429	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-10 (SPAdes)	Environmental
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032722	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_12218570	2170459005	Grass Soil	HAPVWSVWATLEETPSEEIFEGASEEEAMSWINTGGQSWLDDRGRKRNA
deepsgr_01577760	2199352025	Soil	VLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNAWR
F24TB_104281942	3300000550	Soil	PVWSVWAVLEGIPSEEIFEGCSEEEASSWIDTGGQAWLKERRRKRKA*
JGI11643J12802_115987932	3300000890	Soil	VLEGIPSEEIFEGSSEEEASRWINTGGQAWLEDRRRKRSA*
Ga0055500_100256062	3300004062	Natural And Restored Wetlands	KAPHAQVWSVWASLEGTPAEEIFEGSSEQEALDWIATGGQTWLEERRRRRNA*
Ga0066395_100811353	3300004633	Tropical Forest Soil	RKAPHAPVWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA*
Ga0062591_1018675351	3300004643	Soil	HAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA*
Ga0062594_1033335351	3300005093	Soil	HAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINIGGQAWLEERRRKRNA*
Ga0066823_101528401	3300005163	Soil	PVWSVWATLEGTPSEEIFEGASEEEATSWINTGGQSWLDDRRRKRNA*
Ga0066811_10191752	3300005185	Soil	LEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA*
Ga0068996_100094211	3300005218	Natural And Restored Wetlands	LEGTPSEEIFEGSSEEEASNWINTSGQAWLEERRRKRQA*
Ga0070668_1016080143	3300005347	Switchgrass Rhizosphere	WSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA*
Ga0070705_1016379732	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS*
Ga0070708_1020517992	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	WAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS*
Ga0070662_1018082542	3300005457	Corn Rhizosphere	IVRKASHAPVWSVWAVLDDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRSS*
Ga0068855_1012812961	3300005563	Corn Rhizosphere	SVWAALEGVPSEEIFEGSSEEEASNWISTGGQAWLEERKRKRNAR*
Ga0066905_1013731452	3300005713	Tropical Forest Soil	LEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA*
Ga0066903_1005686221	3300005764	Tropical Forest Soil	PSEEIFEASSEEEASSWINTGGQAWLEERRRKRNV*
Ga0066903_1051891632	3300005764	Tropical Forest Soil	EGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA*
Ga0068860_1009940061	3300005843	Switchgrass Rhizosphere	APEEIFEGASEEGAMSWINTGGQSWLDDRRRKRNA*
Ga0068862_1019888301	3300005844	Switchgrass Rhizosphere	RVSHAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA*
Ga0075024_1008020892	3300006047	Watersheds	IWSVWAVTEHSPSEEIFEANSEEEATNWINTSGQTWLEERRRKRSE*
Ga0075363_1005914011	3300006048	Populus Endosphere	TPSEEIFEGTSEVDASSWIDTGGRSWLEERKRKRTA*
Ga0075417_100635161	3300006049	Populus Rhizosphere	PSEEIFEGSSEEEASSWINTGGQAWLDDRRRKRNA*
Ga0075017_1015737222	3300006059	Watersheds	MLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAG*
Ga0075019_109189502	3300006086	Watersheds	MLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAD*
Ga0075030_1007127211	3300006162	Watersheds	KAPHIAIWSVWAMLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAG*
Ga0070715_101833872	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	ASHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS*
Ga0075014_1001995291	3300006174	Watersheds	AIWSVWAMLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAG*
Ga0075522_101899581	3300006638	Arctic Peat Soil	VWAILEGTHSEEIFESSSEEEAKNWLNTGGQTWLEERRQRRSASPLPDHV*
Ga0075521_103756962	3300006642	Arctic Peat Soil	PHGPMWSVWASLEGTHSEEIFEASSEEEASNWINADGQRWLEERRQKRSA*
Ga0075520_12189352	3300006795	Arctic Peat Soil	VIRKAPHVPVWSVWAVLEGTHSEELFEGSTEEEVSNWINSAGQAWLEERRRKRNA*
Ga0075430_1001438952	3300006846	Populus Rhizosphere	MTFSVHTRVSHAPVWSVWATLEGTPSEEIFEGASEEEATSWINTGGQSWLDDRRRKRNA*
Ga0075425_1005534644	3300006854	Populus Rhizosphere	KASHAPIWSVWAVLEGTPSEEIFEGTSEVDASSWIDTGGRSWLEERKRKRTA*
Ga0075425_1008414861	3300006854	Populus Rhizosphere	APHAAVWSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA*
Ga0075425_1025416892	3300006854	Populus Rhizosphere	SHAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA*
Ga0075434_1025280621	3300006871	Populus Rhizosphere	VWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA*
Ga0075426_106262451	3300006903	Populus Rhizosphere	VWSVWAALEGIPSEEIFEGSSEEEASNWISTGGQAWLEERKRKRNAR*
Ga0105251_101140691	3300009011	Switchgrass Rhizosphere	PSEEIFEGSSEEDASSWINSGGRSWLEERRRKRNA*
Ga0105250_101849321	3300009092	Switchgrass Rhizosphere	AVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA*
Ga0105245_127356201	3300009098	Miscanthus Rhizosphere	DTPSEEIFEGASEEEASSWINTGGQAWLGERRRKRSS*
Ga0105243_113726372	3300009148	Miscanthus Rhizosphere	EGIPPEEIFEGSSEEEASSWINIGGQAWLEERRRKRNA*
Ga0075423_101922753	3300009162	Populus Rhizosphere	WAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA*
Ga0105241_103921772	3300009174	Corn Rhizosphere	KLIVRKASHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS*
Ga0105237_101388161	3300009545	Corn Rhizosphere	KLIIRRVSHAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA*
Ga0105855_11037632	3300009649	Permafrost Soil	MWSVWATLEGTHSEEIFEGSSEEEASIWINSGGQKWLEERRQKRSA*
Ga0126372_128864652	3300010360	Tropical Forest Soil	WAVLEGTPSEEIFEGSSEEEASSWINTGRQAWLEERRRKRKA*
Ga0134125_114351012	3300010371	Terrestrial Soil	AAVWSVWAVLEGIPPEEIFEGSSEEEASSWINIGGQAWLEERRRKRNA*
Ga0134128_113971421	3300010373	Terrestrial Soil	RKAPHAQIWSVWAILEGSPSEEIFEGSSEEEASNWIKTGGQTWLEDRKRKRNA*
Ga0134126_105143123	3300010396	Terrestrial Soil	LIVRKAPHAAVWSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA*
Ga0134121_103852381	3300010401	Terrestrial Soil	SEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS*
Ga0120118_10134413	3300012010	Permafrost	HGPVWSVWATLEGTHSEEIFEASSEEEASNWINTAGQTWLEERRQRRNA*
Ga0137383_113445362	3300012199	Vadose Zone Soil	RVSNAPVWSVWATLEGTPSEEIFEGASEEEAINWINTGGQSWLDDRRRKRNA*
Ga0137385_116407891	3300012359	Vadose Zone Soil	TPSEEIFEGASEEEAINWINTGGQSWLDDRRRRRNA*
Ga0126375_110138061	3300012948	Tropical Forest Soil	GAPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA*
Ga0164305_111160601	3300012989	Soil	QIWSVWAVLEGTPSEEIFEGASEEDASSWIKTGGRSWLEECRRKRNA*
Ga0120158_102439981	3300013772	Permafrost	KSATAPWATLEGTHSEEIFEASSEEEASNWINTAGQTWLEERRQRRNA*
Ga0120158_102491493	3300013772	Permafrost	LEGTHSEELFEASSEEEASNWINTDGQTWLEERRQKRNS*
Ga0120149_11709262	3300014058	Permafrost	VWATLEGTHSEELFEASSEEEASNWINTDGQTWLEERRQKRNS*
Ga0182008_103217351	3300014497	Rhizosphere	YAPIGSVWAVLEVPATEEPFEGNSEEDASSWINTGGRSWLEERRRKRTT*
Ga0132255_1028885453	3300015374	Arabidopsis Rhizosphere	WASLEGTAAEEIFEGSSEQEALDWIATGGQTWLEERRQRRNAWPPQTPE*
Ga0182032_108263202	3300016357	Soil	VWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA
Ga0187767_100107975	3300017999	Tropical Peatland	WSVWAVLEGTPSEEIFEGSSEAEASSWINTAGKAWLEERRQKRIA
Ga0187787_104850802	3300018029	Tropical Peatland	PSEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA
Ga0184634_103650061	3300018031	Groundwater Sediment	APVWSVWATLEGTPSEEIFEGTSEEEAMSWINAGGQSWLDDRRRKRNT
Ga0193705_10845481	3300019869	Soil	SHAPVWSVWATLEGTPSEEIFEGTSEEEAMSWINTGGQSWLDDRRRKRNT
Ga0193701_10507211	3300019875	Soil	VWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA
Ga0208850_10322371	3300025457	Arctic Peat Soil	TLEGTHSEELFEGSTEEEASNWINSAGQVWLEERRRKRNA
Ga0208848_11235911	3300025509	Arctic Peat Soil	KLIIRKAPHVPVWSVWATLEGTHSEELFEGSTEEEASNWINSAGQVWLEERRRKRNA
Ga0209385_10072547	3300025650	Arctic Peat Soil	VWSVWAVLEGTHSEELFEGSTEEEASNWINSAGQAWLEERRRKRNA
Ga0207696_11260383	3300025711	Switchgrass Rhizosphere	AVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA
Ga0209176_100031311	3300025854	Arctic Peat Soil	LVIRKAPHVSVWSVWAVLEGTHSEELFEGSTEEEASNWINSAGQAWLEERRRKRNA
Ga0209584_102564462	3300025878	Arctic Peat Soil	VWASLEGTHSEEIFEASSEEEASNWINADGQRWLEERRQKRSA
Ga0207654_102520582	3300025911	Corn Rhizosphere	KLIVRKASHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS
Ga0207659_116203751	3300025926	Miscanthus Rhizosphere	WAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0207711_120708061	3300025941	Switchgrass Rhizosphere	VRKASHAPIWSVWAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0207661_102325873	3300025944	Corn Rhizosphere	KLIVRKASHAPIWSVWAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0207668_114359312	3300025972	Switchgrass Rhizosphere	VLDDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRSS
Ga0207703_119079341	3300026035	Switchgrass Rhizosphere	KLIVRKASHAPVWSVWAVLDDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRSS
Ga0207648_108958591	3300026089	Miscanthus Rhizosphere	TPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS
Ga0207674_100031701	3300026116	Corn Rhizosphere	EGTPSEEIFEGSSEEDASSWINSGGRSWLEERRRKRNA
Ga0209848_10714463	3300026221	Permafrost Soil	VLEGTHSEELFEGSTEEEASNWINSAGQAWLEERRRKRNA
Ga0209839_101088613	3300026294	Soil	VIRKAPHVSVWSVWAVLEGTHSEELFEGSTEEEASNWINSAGQVWLEERRRKRNA
Ga0207511_1040122	3300026802	Soil	RLIVRKASHAPIWSVWAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0209973_10329941	3300027252	Arabidopsis Thaliana Rhizosphere	IVRKAPHAAVWSVWTVLEGIPPEEIFEGSSEEEALSWINTRGQAWLEEHRRKRNA
Ga0207616_1018011	3300027429	Soil	LEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0209177_101498761	3300027775	Agricultural Soil	EGNPPEEIFEGSSEEEASGWIITGGQAWLEERRRKRNG
Ga0209481_100280062	3300027880	Populus Rhizosphere	MLEGTPSEEIFEGASEEEASSWINTGGQAWLDDRRRKRNA
Ga0209382_104052631	3300027909	Populus Rhizosphere	KLIVRKAPHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLKGANAIRSGGAI
Ga0307313_102762441	3300028715	Soil	RKAPHAPVWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRNAWR
Ga0307301_101796741	3300028719	Soil	EEIFEGSSEEEASSWINTGGQAWLEERRRKRNAWR
Ga0307280_101046552	3300028768	Soil	TVRKASNAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA
Ga0307282_105681032	3300028784	Soil	VLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRNS
Ga0307289_103935462	3300028875	Soil	WAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA
Ga0310888_1000068710	3300031538	Soil	AVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0310886_109253481	3300031562	Soil	RKAPHTQVWSVWASLEGTAAEEIFEGSSEQEALDWIATGGQTWLEERRRRRNA
Ga0310813_118258172	3300031716	Soil	HVSIWSVWAVLEGTPSEEIFEGASEEGVTNWIKTGGQVWLEERRQRRKG
Ga0302321_1027864871	3300031726	Fen	RLIIRKAPHAPVWSAWAILEGSPSEEIFEGSSEEEAANWINTNGQAWLEERRRKRNS
Ga0307468_1013355622	3300031740	Hardwood Forest Soil	KLIVRKAPHAAVWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA
Ga0306918_106186042	3300031744	Soil	AVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA
Ga0310892_108639382	3300031858	Soil	AVLEGGPSEEIFEGSSEEEASTWITTSGQAWLEERKRKRAA
Ga0310891_102511962	3300031913	Soil	IIRRVSQAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA
Ga0310912_108841901	3300031941	Soil	SVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA
Ga0310897_107220402	3300032003	Soil	TPSEEIFEGASEEEATSWINTGGQSWLDDRRRKRNA
Ga0310890_108625271	3300032075	Soil	VLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA
Ga0310895_105752152	3300032122	Soil	HAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLKERRQKRNT
Ga0307472_1024481041	3300032205	Hardwood Forest Soil	DDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRNS
Ga0316231_13679482	3300032722	Freshwater	PSEEIFEGASEDEASGWITSNGQAWLDDRRAKRNS