Basic Information | |
---|---|
Family ID | F090935 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 46 residues |
Representative Sequence | WSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 95.37 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.259 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.926 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.593 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 12.33% Coil/Unstructured: 56.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00487 | FA_desaturase | 7.41 |
PF00072 | Response_reg | 2.78 |
PF00211 | Guanylate_cyc | 2.78 |
PF07369 | DUF1488 | 1.85 |
PF13439 | Glyco_transf_4 | 1.85 |
PF13581 | HATPase_c_2 | 1.85 |
PF07536 | HWE_HK | 1.85 |
PF04116 | FA_hydroxylase | 1.85 |
PF00689 | Cation_ATPase_C | 0.93 |
PF03330 | DPBB_1 | 0.93 |
PF13505 | OMP_b-brl | 0.93 |
PF01192 | RNA_pol_Rpb6 | 0.93 |
PF13417 | GST_N_3 | 0.93 |
PF01553 | Acyltransferase | 0.93 |
PF00313 | CSD | 0.93 |
PF08924 | DUF1906 | 0.93 |
PF00528 | BPD_transp_1 | 0.93 |
PF16822 | ALGX | 0.93 |
PF03544 | TonB_C | 0.93 |
PF00027 | cNMP_binding | 0.93 |
PF02472 | ExbD | 0.93 |
PF13432 | TPR_16 | 0.93 |
PF00472 | RF-1 | 0.93 |
PF03401 | TctC | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 7.41 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 7.41 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.78 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 1.85 |
COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 1.85 |
COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 1.85 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.93 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.93 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.93 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.00 % |
Unclassified | root | N/A | 50.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q02H8GT7 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
2199352025|deepsgr__Contig_1001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4171 | Open in IMG/M |
3300000550|F24TB_10428194 | Not Available | 523 | Open in IMG/M |
3300000890|JGI11643J12802_11598793 | Not Available | 526 | Open in IMG/M |
3300004062|Ga0055500_10025606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
3300004633|Ga0066395_10081135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1520 | Open in IMG/M |
3300004643|Ga0062591_101867535 | Not Available | 615 | Open in IMG/M |
3300005093|Ga0062594_103333535 | Not Available | 505 | Open in IMG/M |
3300005163|Ga0066823_10152840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300005185|Ga0066811_1019175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300005218|Ga0068996_10009421 | Not Available | 1328 | Open in IMG/M |
3300005347|Ga0070668_101608014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
3300005440|Ga0070705_101637973 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea | 542 | Open in IMG/M |
3300005445|Ga0070708_102051799 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea | 529 | Open in IMG/M |
3300005457|Ga0070662_101808254 | Not Available | 528 | Open in IMG/M |
3300005563|Ga0068855_101281296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174 | 759 | Open in IMG/M |
3300005713|Ga0066905_101373145 | Not Available | 638 | Open in IMG/M |
3300005764|Ga0066903_100568622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1951 | Open in IMG/M |
3300005764|Ga0066903_105189163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
3300005843|Ga0068860_100994006 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300005844|Ga0068862_101988830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
3300006047|Ga0075024_100802089 | Not Available | 527 | Open in IMG/M |
3300006048|Ga0075363_100591401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 664 | Open in IMG/M |
3300006049|Ga0075417_10063516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1621 | Open in IMG/M |
3300006059|Ga0075017_101573722 | Not Available | 518 | Open in IMG/M |
3300006086|Ga0075019_10918950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121 | 562 | Open in IMG/M |
3300006162|Ga0075030_100712721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 794 | Open in IMG/M |
3300006163|Ga0070715_10183387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1051 | Open in IMG/M |
3300006174|Ga0075014_100199529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1008 | Open in IMG/M |
3300006638|Ga0075522_10189958 | Not Available | 1043 | Open in IMG/M |
3300006642|Ga0075521_10375696 | Not Available | 690 | Open in IMG/M |
3300006795|Ga0075520_1218935 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300006846|Ga0075430_100143895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1985 | Open in IMG/M |
3300006854|Ga0075425_100553464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1324 | Open in IMG/M |
3300006854|Ga0075425_100841486 | Not Available | 1050 | Open in IMG/M |
3300006854|Ga0075425_102541689 | Not Available | 566 | Open in IMG/M |
3300006871|Ga0075434_102528062 | Not Available | 514 | Open in IMG/M |
3300006903|Ga0075426_10626245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174 | 804 | Open in IMG/M |
3300009011|Ga0105251_10114069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1229 | Open in IMG/M |
3300009092|Ga0105250_10184932 | Not Available | 875 | Open in IMG/M |
3300009098|Ga0105245_12735620 | Not Available | 546 | Open in IMG/M |
3300009148|Ga0105243_11372637 | Not Available | 726 | Open in IMG/M |
3300009162|Ga0075423_10192275 | Not Available | 2141 | Open in IMG/M |
3300009174|Ga0105241_10392177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1216 | Open in IMG/M |
3300009545|Ga0105237_10138816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2425 | Open in IMG/M |
3300009649|Ga0105855_1103763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
3300010360|Ga0126372_12886465 | Not Available | 532 | Open in IMG/M |
3300010371|Ga0134125_11435101 | Not Available | 752 | Open in IMG/M |
3300010373|Ga0134128_11397142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 771 | Open in IMG/M |
3300010396|Ga0134126_10514312 | Not Available | 1378 | Open in IMG/M |
3300010401|Ga0134121_10385238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1263 | Open in IMG/M |
3300012010|Ga0120118_1013441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter | 2306 | Open in IMG/M |
3300012199|Ga0137383_11344536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
3300012359|Ga0137385_11640789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
3300012948|Ga0126375_11013806 | Not Available | 677 | Open in IMG/M |
3300012989|Ga0164305_11116060 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300013772|Ga0120158_10243998 | Not Available | 903 | Open in IMG/M |
3300013772|Ga0120158_10249149 | Not Available | 890 | Open in IMG/M |
3300014058|Ga0120149_1170926 | Not Available | 603 | Open in IMG/M |
3300014497|Ga0182008_10321735 | Not Available | 814 | Open in IMG/M |
3300015374|Ga0132255_102888545 | Not Available | 734 | Open in IMG/M |
3300016357|Ga0182032_10826320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
3300017999|Ga0187767_10010797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1788 | Open in IMG/M |
3300018029|Ga0187787_10485080 | Not Available | 504 | Open in IMG/M |
3300018031|Ga0184634_10365006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300019869|Ga0193705_1084548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
3300019875|Ga0193701_1050721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
3300025457|Ga0208850_1032237 | Not Available | 899 | Open in IMG/M |
3300025509|Ga0208848_1123591 | Not Available | 508 | Open in IMG/M |
3300025650|Ga0209385_1007254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4683 | Open in IMG/M |
3300025711|Ga0207696_1126038 | Not Available | 689 | Open in IMG/M |
3300025854|Ga0209176_10003131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2967 | Open in IMG/M |
3300025878|Ga0209584_10256446 | Not Available | 670 | Open in IMG/M |
3300025911|Ga0207654_10252058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1184 | Open in IMG/M |
3300025926|Ga0207659_11620375 | Not Available | 552 | Open in IMG/M |
3300025941|Ga0207711_12070806 | Not Available | 512 | Open in IMG/M |
3300025944|Ga0207661_10232587 | Not Available | 1633 | Open in IMG/M |
3300025972|Ga0207668_11435931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 622 | Open in IMG/M |
3300026035|Ga0207703_11907934 | Not Available | 570 | Open in IMG/M |
3300026089|Ga0207648_10895859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 829 | Open in IMG/M |
3300026116|Ga0207674_10003170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 20247 | Open in IMG/M |
3300026221|Ga0209848_1071446 | Not Available | 615 | Open in IMG/M |
3300026294|Ga0209839_10108861 | Not Available | 941 | Open in IMG/M |
3300026802|Ga0207511_104012 | Not Available | 696 | Open in IMG/M |
3300027252|Ga0209973_1032994 | Not Available | 737 | Open in IMG/M |
3300027429|Ga0207616_101801 | Not Available | 628 | Open in IMG/M |
3300027775|Ga0209177_10149876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 790 | Open in IMG/M |
3300027880|Ga0209481_10028006 | Not Available | 2534 | Open in IMG/M |
3300027909|Ga0209382_10405263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
3300028715|Ga0307313_10276244 | Not Available | 523 | Open in IMG/M |
3300028719|Ga0307301_10179674 | Not Available | 685 | Open in IMG/M |
3300028768|Ga0307280_10104655 | Not Available | 944 | Open in IMG/M |
3300028784|Ga0307282_10568103 | Not Available | 550 | Open in IMG/M |
3300028875|Ga0307289_10393546 | Not Available | 570 | Open in IMG/M |
3300031538|Ga0310888_10000687 | All Organisms → cellular organisms → Bacteria | 8775 | Open in IMG/M |
3300031562|Ga0310886_10925348 | Not Available | 555 | Open in IMG/M |
3300031716|Ga0310813_11825817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300031726|Ga0302321_102786487 | Not Available | 571 | Open in IMG/M |
3300031740|Ga0307468_101335562 | Not Available | 655 | Open in IMG/M |
3300031744|Ga0306918_10618604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 849 | Open in IMG/M |
3300031858|Ga0310892_10863938 | Not Available | 631 | Open in IMG/M |
3300031913|Ga0310891_10251196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
3300031941|Ga0310912_10884190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
3300032003|Ga0310897_10722040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300032075|Ga0310890_10862527 | Not Available | 720 | Open in IMG/M |
3300032122|Ga0310895_10575215 | Not Available | 575 | Open in IMG/M |
3300032205|Ga0307472_102448104 | Not Available | 530 | Open in IMG/M |
3300032722|Ga0316231_1367948 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Solanales → Solanaceae → Solanoideae → Solaneae → Solanum → Solanum subgen. Lycopersicon → Solanum lycopersicum | 543 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.33% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.48% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.63% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.78% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026802 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-C (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027429 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-10 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_12218570 | 2170459005 | Grass Soil | HAPVWSVWATLEETPSEEIFEGASEEEAMSWINTGGQSWLDDRGRKRNA |
deepsgr_01577760 | 2199352025 | Soil | VLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNAWR |
F24TB_104281942 | 3300000550 | Soil | PVWSVWAVLEGIPSEEIFEGCSEEEASSWIDTGGQAWLKERRRKRKA* |
JGI11643J12802_115987932 | 3300000890 | Soil | VLEGIPSEEIFEGSSEEEASRWINTGGQAWLEDRRRKRSA* |
Ga0055500_100256062 | 3300004062 | Natural And Restored Wetlands | KAPHAQVWSVWASLEGTPAEEIFEGSSEQEALDWIATGGQTWLEERRRRRNA* |
Ga0066395_100811353 | 3300004633 | Tropical Forest Soil | RKAPHAPVWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA* |
Ga0062591_1018675351 | 3300004643 | Soil | HAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA* |
Ga0062594_1033335351 | 3300005093 | Soil | HAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINIGGQAWLEERRRKRNA* |
Ga0066823_101528401 | 3300005163 | Soil | PVWSVWATLEGTPSEEIFEGASEEEATSWINTGGQSWLDDRRRKRNA* |
Ga0066811_10191752 | 3300005185 | Soil | LEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA* |
Ga0068996_100094211 | 3300005218 | Natural And Restored Wetlands | LEGTPSEEIFEGSSEEEASNWINTSGQAWLEERRRKRQA* |
Ga0070668_1016080143 | 3300005347 | Switchgrass Rhizosphere | WSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA* |
Ga0070705_1016379732 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS* |
Ga0070708_1020517992 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | WAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS* |
Ga0070662_1018082542 | 3300005457 | Corn Rhizosphere | IVRKASHAPVWSVWAVLDDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRSS* |
Ga0068855_1012812961 | 3300005563 | Corn Rhizosphere | SVWAALEGVPSEEIFEGSSEEEASNWISTGGQAWLEERKRKRNAR* |
Ga0066905_1013731452 | 3300005713 | Tropical Forest Soil | LEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA* |
Ga0066903_1005686221 | 3300005764 | Tropical Forest Soil | PSEEIFEASSEEEASSWINTGGQAWLEERRRKRNV* |
Ga0066903_1051891632 | 3300005764 | Tropical Forest Soil | EGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA* |
Ga0068860_1009940061 | 3300005843 | Switchgrass Rhizosphere | APEEIFEGASEEGAMSWINTGGQSWLDDRRRKRNA* |
Ga0068862_1019888301 | 3300005844 | Switchgrass Rhizosphere | RVSHAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA* |
Ga0075024_1008020892 | 3300006047 | Watersheds | IWSVWAVTEHSPSEEIFEANSEEEATNWINTSGQTWLEERRRKRSE* |
Ga0075363_1005914011 | 3300006048 | Populus Endosphere | TPSEEIFEGTSEVDASSWIDTGGRSWLEERKRKRTA* |
Ga0075417_100635161 | 3300006049 | Populus Rhizosphere | PSEEIFEGSSEEEASSWINTGGQAWLDDRRRKRNA* |
Ga0075017_1015737222 | 3300006059 | Watersheds | MLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAG* |
Ga0075019_109189502 | 3300006086 | Watersheds | MLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAD* |
Ga0075030_1007127211 | 3300006162 | Watersheds | KAPHIAIWSVWAMLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAG* |
Ga0070715_101833872 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ASHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS* |
Ga0075014_1001995291 | 3300006174 | Watersheds | AIWSVWAMLEGTPSEEIFEGSSEEEASSWIKTGGQDWLAERKRKRAG* |
Ga0075522_101899581 | 3300006638 | Arctic Peat Soil | VWAILEGTHSEEIFESSSEEEAKNWLNTGGQTWLEERRQRRSASPLPDHV* |
Ga0075521_103756962 | 3300006642 | Arctic Peat Soil | PHGPMWSVWASLEGTHSEEIFEASSEEEASNWINADGQRWLEERRQKRSA* |
Ga0075520_12189352 | 3300006795 | Arctic Peat Soil | VIRKAPHVPVWSVWAVLEGTHSEELFEGSTEEEVSNWINSAGQAWLEERRRKRNA* |
Ga0075430_1001438952 | 3300006846 | Populus Rhizosphere | MTFSVHTRVSHAPVWSVWATLEGTPSEEIFEGASEEEATSWINTGGQSWLDDRRRKRNA* |
Ga0075425_1005534644 | 3300006854 | Populus Rhizosphere | KASHAPIWSVWAVLEGTPSEEIFEGTSEVDASSWIDTGGRSWLEERKRKRTA* |
Ga0075425_1008414861 | 3300006854 | Populus Rhizosphere | APHAAVWSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA* |
Ga0075425_1025416892 | 3300006854 | Populus Rhizosphere | SHAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA* |
Ga0075434_1025280621 | 3300006871 | Populus Rhizosphere | VWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA* |
Ga0075426_106262451 | 3300006903 | Populus Rhizosphere | VWSVWAALEGIPSEEIFEGSSEEEASNWISTGGQAWLEERKRKRNAR* |
Ga0105251_101140691 | 3300009011 | Switchgrass Rhizosphere | PSEEIFEGSSEEDASSWINSGGRSWLEERRRKRNA* |
Ga0105250_101849321 | 3300009092 | Switchgrass Rhizosphere | AVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA* |
Ga0105245_127356201 | 3300009098 | Miscanthus Rhizosphere | DTPSEEIFEGASEEEASSWINTGGQAWLGERRRKRSS* |
Ga0105243_113726372 | 3300009148 | Miscanthus Rhizosphere | EGIPPEEIFEGSSEEEASSWINIGGQAWLEERRRKRNA* |
Ga0075423_101922753 | 3300009162 | Populus Rhizosphere | WAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA* |
Ga0105241_103921772 | 3300009174 | Corn Rhizosphere | KLIVRKASHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS* |
Ga0105237_101388161 | 3300009545 | Corn Rhizosphere | KLIIRRVSHAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA* |
Ga0105855_11037632 | 3300009649 | Permafrost Soil | MWSVWATLEGTHSEEIFEGSSEEEASIWINSGGQKWLEERRQKRSA* |
Ga0126372_128864652 | 3300010360 | Tropical Forest Soil | WAVLEGTPSEEIFEGSSEEEASSWINTGRQAWLEERRRKRKA* |
Ga0134125_114351012 | 3300010371 | Terrestrial Soil | AAVWSVWAVLEGIPPEEIFEGSSEEEASSWINIGGQAWLEERRRKRNA* |
Ga0134128_113971421 | 3300010373 | Terrestrial Soil | RKAPHAQIWSVWAILEGSPSEEIFEGSSEEEASNWIKTGGQTWLEDRKRKRNA* |
Ga0134126_105143123 | 3300010396 | Terrestrial Soil | LIVRKAPHAAVWSVWAVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA* |
Ga0134121_103852381 | 3300010401 | Terrestrial Soil | SEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS* |
Ga0120118_10134413 | 3300012010 | Permafrost | HGPVWSVWATLEGTHSEEIFEASSEEEASNWINTAGQTWLEERRQRRNA* |
Ga0137383_113445362 | 3300012199 | Vadose Zone Soil | RVSNAPVWSVWATLEGTPSEEIFEGASEEEAINWINTGGQSWLDDRRRKRNA* |
Ga0137385_116407891 | 3300012359 | Vadose Zone Soil | TPSEEIFEGASEEEAINWINTGGQSWLDDRRRRRNA* |
Ga0126375_110138061 | 3300012948 | Tropical Forest Soil | GAPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA* |
Ga0164305_111160601 | 3300012989 | Soil | QIWSVWAVLEGTPSEEIFEGASEEDASSWIKTGGRSWLEECRRKRNA* |
Ga0120158_102439981 | 3300013772 | Permafrost | KSATAPWATLEGTHSEEIFEASSEEEASNWINTAGQTWLEERRQRRNA* |
Ga0120158_102491493 | 3300013772 | Permafrost | LEGTHSEELFEASSEEEASNWINTDGQTWLEERRQKRNS* |
Ga0120149_11709262 | 3300014058 | Permafrost | VWATLEGTHSEELFEASSEEEASNWINTDGQTWLEERRQKRNS* |
Ga0182008_103217351 | 3300014497 | Rhizosphere | YAPIGSVWAVLEVPATEEPFEGNSEEDASSWINTGGRSWLEERRRKRTT* |
Ga0132255_1028885453 | 3300015374 | Arabidopsis Rhizosphere | WASLEGTAAEEIFEGSSEQEALDWIATGGQTWLEERRQRRNAWPPQTPE* |
Ga0182032_108263202 | 3300016357 | Soil | VWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA |
Ga0187767_100107975 | 3300017999 | Tropical Peatland | WSVWAVLEGTPSEEIFEGSSEAEASSWINTAGKAWLEERRQKRIA |
Ga0187787_104850802 | 3300018029 | Tropical Peatland | PSEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA |
Ga0184634_103650061 | 3300018031 | Groundwater Sediment | APVWSVWATLEGTPSEEIFEGTSEEEAMSWINAGGQSWLDDRRRKRNT |
Ga0193705_10845481 | 3300019869 | Soil | SHAPVWSVWATLEGTPSEEIFEGTSEEEAMSWINTGGQSWLDDRRRKRNT |
Ga0193701_10507211 | 3300019875 | Soil | VWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA |
Ga0208850_10322371 | 3300025457 | Arctic Peat Soil | TLEGTHSEELFEGSTEEEASNWINSAGQVWLEERRRKRNA |
Ga0208848_11235911 | 3300025509 | Arctic Peat Soil | KLIIRKAPHVPVWSVWATLEGTHSEELFEGSTEEEASNWINSAGQVWLEERRRKRNA |
Ga0209385_10072547 | 3300025650 | Arctic Peat Soil | VWSVWAVLEGTHSEELFEGSTEEEASNWINSAGQAWLEERRRKRNA |
Ga0207696_11260383 | 3300025711 | Switchgrass Rhizosphere | AVLEGTPSEEIFEGSSEEEASNWINTGGQAWLKERRRKRNA |
Ga0209176_100031311 | 3300025854 | Arctic Peat Soil | LVIRKAPHVSVWSVWAVLEGTHSEELFEGSTEEEASNWINSAGQAWLEERRRKRNA |
Ga0209584_102564462 | 3300025878 | Arctic Peat Soil | VWASLEGTHSEEIFEASSEEEASNWINADGQRWLEERRQKRSA |
Ga0207654_102520582 | 3300025911 | Corn Rhizosphere | KLIVRKASHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS |
Ga0207659_116203751 | 3300025926 | Miscanthus Rhizosphere | WAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0207711_120708061 | 3300025941 | Switchgrass Rhizosphere | VRKASHAPIWSVWAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0207661_102325873 | 3300025944 | Corn Rhizosphere | KLIVRKASHAPIWSVWAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0207668_114359312 | 3300025972 | Switchgrass Rhizosphere | VLDDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRSS |
Ga0207703_119079341 | 3300026035 | Switchgrass Rhizosphere | KLIVRKASHAPVWSVWAVLDDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRSS |
Ga0207648_108958591 | 3300026089 | Miscanthus Rhizosphere | TPSEEIFEGSSEEEASSWINTGGQAWLEERRRIRNS |
Ga0207674_100031701 | 3300026116 | Corn Rhizosphere | EGTPSEEIFEGSSEEDASSWINSGGRSWLEERRRKRNA |
Ga0209848_10714463 | 3300026221 | Permafrost Soil | VLEGTHSEELFEGSTEEEASNWINSAGQAWLEERRRKRNA |
Ga0209839_101088613 | 3300026294 | Soil | VIRKAPHVSVWSVWAVLEGTHSEELFEGSTEEEASNWINSAGQVWLEERRRKRNA |
Ga0207511_1040122 | 3300026802 | Soil | RLIVRKASHAPIWSVWAVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0209973_10329941 | 3300027252 | Arabidopsis Thaliana Rhizosphere | IVRKAPHAAVWSVWTVLEGIPPEEIFEGSSEEEALSWINTRGQAWLEEHRRKRNA |
Ga0207616_1018011 | 3300027429 | Soil | LEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0209177_101498761 | 3300027775 | Agricultural Soil | EGNPPEEIFEGSSEEEASGWIITGGQAWLEERRRKRNG |
Ga0209481_100280062 | 3300027880 | Populus Rhizosphere | MLEGTPSEEIFEGASEEEASSWINTGGQAWLDDRRRKRNA |
Ga0209382_104052631 | 3300027909 | Populus Rhizosphere | KLIVRKAPHAPVWSVWAVLEGTPSEEIFEGSSEEEASSWINTGGQAWLKGANAIRSGGAI |
Ga0307313_102762441 | 3300028715 | Soil | RKAPHAPVWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRNAWR |
Ga0307301_101796741 | 3300028719 | Soil | EEIFEGSSEEEASSWINTGGQAWLEERRRKRNAWR |
Ga0307280_101046552 | 3300028768 | Soil | TVRKASNAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA |
Ga0307282_105681032 | 3300028784 | Soil | VLEGTPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRNS |
Ga0307289_103935462 | 3300028875 | Soil | WAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLEERRRKRNA |
Ga0310888_1000068710 | 3300031538 | Soil | AVLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0310886_109253481 | 3300031562 | Soil | RKAPHTQVWSVWASLEGTAAEEIFEGSSEQEALDWIATGGQTWLEERRRRRNA |
Ga0310813_118258172 | 3300031716 | Soil | HVSIWSVWAVLEGTPSEEIFEGASEEGVTNWIKTGGQVWLEERRQRRKG |
Ga0302321_1027864871 | 3300031726 | Fen | RLIIRKAPHAPVWSAWAILEGSPSEEIFEGSSEEEAANWINTNGQAWLEERRRKRNS |
Ga0307468_1013355622 | 3300031740 | Hardwood Forest Soil | KLIVRKAPHAAVWSVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA |
Ga0306918_106186042 | 3300031744 | Soil | AVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA |
Ga0310892_108639382 | 3300031858 | Soil | AVLEGGPSEEIFEGSSEEEASTWITTSGQAWLEERKRKRAA |
Ga0310891_102511962 | 3300031913 | Soil | IIRRVSQAPVWSVWATLEGTPSEEIFEGASEEEAMSWINTGGQSWLDDRRRKRNA |
Ga0310912_108841901 | 3300031941 | Soil | SVWAVLEGIPSEEIFEGSSEEEASSWINTGGQAWLEERRRKRKA |
Ga0310897_107220402 | 3300032003 | Soil | TPSEEIFEGASEEEATSWINTGGQSWLDDRRRKRNA |
Ga0310890_108625271 | 3300032075 | Soil | VLEGTPSEEIFEGSSEEDASSWINTGGRSWLEERRRKRNA |
Ga0310895_105752152 | 3300032122 | Soil | HAAVWSVWAVLEGIPPEEIFEGSSEEEASSWINTGGQAWLKERRQKRNT |
Ga0307472_1024481041 | 3300032205 | Hardwood Forest Soil | DDTPSEEIFEGSSEEEASSWINTGGQAWLGERRRKRNS |
Ga0316231_13679482 | 3300032722 | Freshwater | PSEEIFEGASEDEASGWITSNGQAWLDDRRAKRNS |
⦗Top⦘ |