Metagenome / Metatranscriptome Family F090934

Overview

Basic Information

• Family ID: F090934
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 108
• Average Sequence Length: 44 residues
• Representative Sequence: MKTLISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT
• Number of Associated Samples: 54
• Number of Associated Scaffolds: 108

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 76.85 %
• % of genes near scaffold ends (potentially truncated): 17.59 %
• % of genes from short scaffolds (< 2000 bps): 77.78 %
• Associated GOLD sequencing projects: 48
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (58.333 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (25.000 % of family members)
• Environment Ontology (ENVO): Unclassified (52.778 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (46.296 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 48.61%
  β-sheet: 0.00%
  Coil/Unstructured: 51.39%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF12770	CHAT	6.48
PF04055	Radical_SAM	4.63
PF06463	Mob_synth_C	4.63
PF01979	Amidohydro_1	2.78
PF06808	DctM	2.78
PF02668	TauD	2.78
PF01755	Glyco_transf_25	1.85
PF00941	FAD_binding_5	0.93
PF13193	AMP-binding_C	0.93
PF13231	PMT_2	0.93
PF05231	MASE1	0.93
PF00753	Lactamase_B	0.93
PF13546	DDE_5	0.93
PF03328	HpcH_HpaI	0.93
PF14031	D-ser_dehydrat	0.93
PF00005	ABC_tran	0.93
PF04972	BON	0.93
PF03232	COQ7	0.93
PF00270	DEAD	0.93
PF13545	HTH_Crp_2	0.93
PF00156	Pribosyltran	0.93
PF16576	HlyD_D23	0.93
PF13426	PAS_9	0.93
PF00501	AMP-binding	0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG2896	GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)	Coenzyme transport and metabolism [H]	4.63
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.78
COG3306	Glycosyltransferase involved in LPS biosynthesis, GR25 family	Cell wall/membrane/envelope biogenesis [M]	1.85
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.93
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.93
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.93
COG2941	Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis)	Coenzyme transport and metabolism [H]	0.93
COG3447	Integral membrane sensor domain MASE1	Signal transduction mechanisms [T]	0.93
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.93
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.93

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.33 %
Unclassified	root	N/A	41.67 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.33 %
Unclassified	root	N/A	41.67 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.33 %
Unclassified	root	N/A	41.67 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	39.81 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	37.04 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.93 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	25.00 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.78 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.93 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.93 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.78 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2.78 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.93 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.93 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.78 %
unclassified Rhodobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae	0.93 %
Filomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium	0.93 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.93 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.93 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.67 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.78 %
Hyphomicrobium denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	0.93 %
Filomicrobium insigne	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Filomicrobium insigne	0.93 %
Rhodobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	0.93 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.93 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000363|ICChiseqgaiiFebDRAFT_12762783	Not Available	526
3300000550|F24TB_10070305	Not Available	803
3300000858|JGI10213J12805_10006612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1562
3300004281|Ga0066397_10129374	Not Available	558
3300004479|Ga0062595_100797656	Not Available	777
3300005332|Ga0066388_100006911	All Organisms → cellular organisms → Bacteria → Proteobacteria	8233
3300005332|Ga0066388_100460966	All Organisms → cellular organisms → Bacteria	1912
3300005332|Ga0066388_100661323	All Organisms → cellular organisms → Bacteria	1658
3300005332|Ga0066388_102203507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	994
3300005332|Ga0066388_102416966	All Organisms → cellular organisms → Bacteria	953
3300005332|Ga0066388_102566672	Not Available	927
3300005332|Ga0066388_103157521	Not Available	842
3300005332|Ga0066388_105948652	Not Available	616
3300005332|Ga0066388_108213625	Not Available	521
3300005332|Ga0066388_108776228	Not Available	502
3300005341|Ga0070691_10006658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5289
3300005713|Ga0066905_100000836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9609
3300005713|Ga0066905_100003435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6230
3300005713|Ga0066905_100032908	All Organisms → cellular organisms → Bacteria	2968
3300005713|Ga0066905_100133829	All Organisms → cellular organisms → Bacteria	1756
3300005713|Ga0066905_100179809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1559
3300005713|Ga0066905_100186121	Not Available	1537
3300005713|Ga0066905_100239752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1385
3300005713|Ga0066905_100366780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1156
3300005713|Ga0066905_100470030	Not Available	1038
3300005713|Ga0066905_101118523	Not Available	700
3300005713|Ga0066905_102303825	Not Available	503
3300005719|Ga0068861_100123459	All Organisms → cellular organisms → Bacteria	2092
3300005764|Ga0066903_100285275	Not Available	2593
3300005764|Ga0066903_100301070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2537
3300005764|Ga0066903_101379334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1322
3300005937|Ga0081455_10000412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	56264
3300005937|Ga0081455_10000994	All Organisms → cellular organisms → Bacteria	35958
3300005983|Ga0081540_1000205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	61689
3300005983|Ga0081540_1000515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	37910
3300006163|Ga0070715_10184996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1047
3300006196|Ga0075422_10048368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Filomicrobium → Filomicrobium insigne	1534
3300006358|Ga0068871_101214342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	707
3300006844|Ga0075428_100136182	All Organisms → cellular organisms → Bacteria	2670
3300006852|Ga0075433_10003351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12384
3300006852|Ga0075433_10251082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1569
3300006852|Ga0075433_10322482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1367
3300006852|Ga0075433_10433357	Not Available	1159
3300006871|Ga0075434_100843521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	932
3300006904|Ga0075424_102081340	Not Available	598
3300009094|Ga0111539_10010044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11930
3300009094|Ga0111539_10270846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1976
3300009094|Ga0111539_10699527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1180
3300009094|Ga0111539_11505537	All Organisms → cellular organisms → Bacteria	780
3300009094|Ga0111539_12385205	Not Available	614
3300009100|Ga0075418_10451544	All Organisms → cellular organisms → Bacteria	1377
3300009100|Ga0075418_12167543	Not Available	606
3300009100|Ga0075418_12241090	Not Available	596
3300009146|Ga0105091_10126515	Not Available	1187
3300009156|Ga0111538_11104733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1003
3300009156|Ga0111538_12858613	Not Available	604
3300009168|Ga0105104_10606010	Not Available	623
3300009987|Ga0105030_128537	Not Available	515
3300010043|Ga0126380_10022341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3062
3300010043|Ga0126380_10152763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1481
3300010043|Ga0126380_11279411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	637
3300010046|Ga0126384_10000111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	35873
3300010047|Ga0126382_10057761	All Organisms → cellular organisms → Bacteria	2311
3300010047|Ga0126382_10295486	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213
3300010047|Ga0126382_10690498	Not Available	855
3300010047|Ga0126382_10730434	Not Available	835
3300010047|Ga0126382_11022703	Not Available	726
3300010360|Ga0126372_10316768	All Organisms → cellular organisms → Bacteria	1380
3300010360|Ga0126372_10705228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	986
3300010362|Ga0126377_10110064	All Organisms → cellular organisms → Bacteria	2528
3300010362|Ga0126377_10366068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1443
3300010362|Ga0126377_10928816	Not Available	934
3300010362|Ga0126377_12838272	Not Available	559
3300010362|Ga0126377_13095481	Not Available	537
3300010398|Ga0126383_12327755	Not Available	621
3300010400|Ga0134122_10007932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7915
3300010868|Ga0124844_1320901	Not Available	510
3300012496|Ga0157353_1035255	Not Available	552
3300015371|Ga0132258_10136080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5868
3300015371|Ga0132258_11376453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1783
3300015372|Ga0132256_102123338	Not Available	667
3300025905|Ga0207685_10549350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	614
3300025937|Ga0207669_11800225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	523
3300026067|Ga0207678_11797248	Not Available	537
3300026118|Ga0207675_100276872	All Organisms → cellular organisms → Bacteria	1629
3300027646|Ga0209466_1108385	Not Available	564
3300027787|Ga0209074_10142989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	853
3300027907|Ga0207428_10021995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5387
3300027907|Ga0207428_10310462	Not Available	1166
3300027907|Ga0207428_10414226	All Organisms → cellular organisms → Bacteria	986
3300027907|Ga0207428_10457138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	930
3300031677|Ga0307480_1008049	Not Available	698
3300031677|Ga0307480_1008959	Not Available	675
3300031677|Ga0307480_1024266	Not Available	504
3300031720|Ga0307469_10068843	All Organisms → cellular organisms → Bacteria	2334
3300031740|Ga0307468_100042499	Not Available	2295
3300031740|Ga0307468_100262292	Not Available	1224
3300031820|Ga0307473_10378776	All Organisms → cellular organisms → Bacteria	920
3300031820|Ga0307473_10588168	All Organisms → cellular organisms → Bacteria	766
3300031858|Ga0310892_10556713	Not Available	771
3300032075|Ga0310890_11235941	Not Available	609
3300032174|Ga0307470_10204140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1266
3300032174|Ga0307470_10926227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	687
3300032180|Ga0307471_101283592	All Organisms → cellular organisms → Bacteria	895
3300032205|Ga0307472_100399086	All Organisms → cellular organisms → Bacteria	1149
3300032205|Ga0307472_100913175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	814
3300034818|Ga0373950_0117692	Not Available	585
3300034820|Ga0373959_0090668	Not Available	716

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.74%
Host-Associated	Host-Associated	34.26%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.89%
Plants	Host-Associated → Plants	34.26%
Aquatic	Environmental → Aquatic	1.85%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.93%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.41%
Freshwater	Environmental → Aquatic → Freshwater	1.85%
Roots	Host-Associated → Plants → Roots	0.93%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.19%
Loam	Environmental → Terrestrial → Soil → Loam	28.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	21.30%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.56%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.63%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.85%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%

Subtype

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	25.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	21.30%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.63%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.78%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%

Habitat

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	25.00%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	20.37%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	15.74%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	12.04%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	3.70%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.78%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.85%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	1.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.93%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental
3300004281	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio	Environmental
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental
3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Host-Associated
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental
3300012496	Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015372	Soil combined assembly	Host-Associated
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300031677	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Host-Associated
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiFebDRAFT_127627832	3300000363	Soil	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVSDLS*
F24TB_100703052	3300000550	Soil	MKTVISALVALSILSGYSASAFADKVPQSIWEQLDREGRGGHPT*
JGI10213J12805_100066124	3300000858	Soil	MKTVLSALIALSVLSGFAASASADRVPQSIWEQLDRDGRGGHPT*
Ga0066397_101293742	3300004281	Tropical Forest Soil	MKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHPG*
Ga0062595_1007976561	3300004479	Soil	MKTLICAVVALSVLSGYAGSAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066388_1000069116	3300005332	Tropical Forest Soil	MKTLMSALVALAVLAGSAASALADKVPPSIWEQLDREGHSISG*
Ga0066388_1004609662	3300005332	Tropical Forest Soil	MKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHAG*
Ga0066388_1006613231	3300005332	Tropical Forest Soil	MKRIMSGLLALSVLLGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066388_1022035073	3300005332	Tropical Forest Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0066388_1024169662	3300005332	Tropical Forest Soil	VEDPAIKALLSTVLALSLLSGYAASALADKVPQSIWDELDRDGRGGHPT*
Ga0066388_1025666721	3300005332	Tropical Forest Soil	MKTVISALVALSVLSGYAASALADKVPQSIWEQLDRDGRGGHPT*
Ga0066388_1031575212	3300005332	Tropical Forest Soil	MKRLLSALVALSVVSGYAATALADQVPQSIWEQLDSDGRGGHPT*
Ga0066388_1059486522	3300005332	Tropical Forest Soil	MKALFSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGG
Ga0066388_1082136251	3300005332	Tropical Forest Soil	MKMIVSAFLALSVLTGYAASALADKVPPAILEQLDREGHAS*
Ga0066388_1087762281	3300005332	Tropical Forest Soil	MKTLISALVALSVLSGYAASAMADKVPPSIWEQLDREGRGGHPT*
Ga0070691_100066587	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVISALVALSALSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0066905_1000008366	3300005713	Tropical Forest Soil	MKAILSALVALSVLSGTAGSALADKVPASIWEQLDRDGH*
Ga0066905_1000034354	3300005713	Tropical Forest Soil	MQTLISALVALSILSGSAASALADKVPPSIWEQLDRDGRGGHPT*
Ga0066905_1000329083	3300005713	Tropical Forest Soil	MKMMISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066905_1001338291	3300005713	Tropical Forest Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGR
Ga0066905_1001798093	3300005713	Tropical Forest Soil	MKTLISALLALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPS*
Ga0066905_1001861213	3300005713	Tropical Forest Soil	MKMLISGLVALSVLSGYGASALADKVPQSIWEQLDRDGRGGHLI*
Ga0066905_1002397522	3300005713	Tropical Forest Soil	MKTLLSALVALSVVSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0066905_1003667804	3300005713	Tropical Forest Soil	MKALFSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0066905_1004700302	3300005713	Tropical Forest Soil	MKTLISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066905_1011185231	3300005713	Tropical Forest Soil	SGTMQTLISALVALSILSGSAAPALADKVPQSIWEQLDWDGRGGHPT*
Ga0066905_1023038251	3300005713	Tropical Forest Soil	MKTLISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0068861_1001234593	3300005719	Switchgrass Rhizosphere	MKRIISALLVLSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0066903_1002852754	3300005764	Tropical Forest Soil	LRRIAIKALFCVLLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0066903_1003010704	3300005764	Tropical Forest Soil	MKRLLSALVALSVVSGYAATALADQVPQSIWEQLDREGRGGHPT*
Ga0066903_1013793341	3300005764	Tropical Forest Soil	IEAVVISGLLALSVLSGYAGSAMADKVPPSIWERLDRDGRGGHPT*
Ga0081455_1000041219	3300005937	Tabebuia Heterophylla Rhizosphere	MQTLISALVALSVLSGSAASALADKVPPSIWEQLDRDGRGGHPT*
Ga0081455_1000099450	3300005937	Tabebuia Heterophylla Rhizosphere	MQTLISALVALSILSGSAASALADKVPRSIWEQLDWDGRGGHPT*
Ga0081540_100020537	3300005983	Tabebuia Heterophylla Rhizosphere	MKMIVSALLALSVLSGYAASALADKVPPAIWEQLDRDGHPT*
Ga0081540_10005157	3300005983	Tabebuia Heterophylla Rhizosphere	MKTMISALVVLSVLSGYAASAFADKVPKSIWEQLDREGYGGDSTIS*
Ga0070715_101849962	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVISALLALSVLSGYAASAFADKVPQSIWEELDRDGRGGHPT*
Ga0075422_100483683	3300006196	Populus Rhizosphere	ALKTIMSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT*
Ga0068871_1012143421	3300006358	Miscanthus Rhizosphere	SALVALSVLSGYAASAFADKVPQSIWEQLDRDGRGGHPT*
Ga0075428_1001361823	3300006844	Populus Rhizosphere	MKTVISALVALSILSGYSASAFADKVPQSIWEQLDREGHGGHPT*
Ga0075433_100033515	3300006852	Populus Rhizosphere	MKTIMSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT*
Ga0075433_102510822	3300006852	Populus Rhizosphere	MKTLICAVVALSVLSGYAASAIADKVPPSIWEQLDRDGRGGHPT*
Ga0075433_103224823	3300006852	Populus Rhizosphere	MKAVLSAFVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0075433_104333572	3300006852	Populus Rhizosphere	MKRIISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0075434_1008435211	3300006871	Populus Rhizosphere	VLSAFVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0075424_1020813402	3300006904	Populus Rhizosphere	MKTLMSVLVTLAVLSGSTASALADKVPPSIWEQLDREGHSHSG*
Ga0111539_100100445	3300009094	Populus Rhizosphere	MSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT*
Ga0111539_102708461	3300009094	Populus Rhizosphere	HAQRRNTMKTLICAVVALSVLSGYAGSAMADKVPPSIWEQLDRDGRGGHPT*
Ga0111539_106995271	3300009094	Populus Rhizosphere	MKTVISALVALSVVSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0111539_115055372	3300009094	Populus Rhizosphere	SALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVSDLS*
Ga0111539_123852052	3300009094	Populus Rhizosphere	MKTVICALVVLSIMSGYAASAFADKVPQSIWEQLDREGRGGHP
Ga0075418_104515441	3300009100	Populus Rhizosphere	MKTLLSAFLALSVLSGYAATAMADKVPPSIWEQLDRDGRGSHPT*
Ga0075418_121675431	3300009100	Populus Rhizosphere	MSALLALSVVSGYAATAFADTVPQSIWEQLDREGRG
Ga0075418_122410902	3300009100	Populus Rhizosphere	MKTLICAVVALSVLSGYAASAIADKVPPSIWEQLDRDG
Ga0105091_101265152	3300009146	Freshwater Sediment	MKTLVAALVALSVLSGYAASALADKVPQSIWEQLDRDGRGGRPT*
Ga0111538_111047333	3300009156	Populus Rhizosphere	MKTLLSAFLALSVLSGYAAKAMADKVPPSIWEQLDRDGRGGHPT*
Ga0111538_128586132	3300009156	Populus Rhizosphere	LSIMSGYAASAFADKVPQSIWEQLDREGRGGHPA*
Ga0105104_106060101	3300009168	Freshwater Sediment	MKTVISALVALSIMSGYAASAFADKVPQSIWEQLDREGRGGHPA*
Ga0105030_1285372	3300009987	Switchgrass Rhizosphere	MIMRTIVSALVALSVLSGSAAVAFAEKAPRSIWEQLDREGRGGTTT*
Ga0126380_100223415	3300010043	Tropical Forest Soil	MLAARAQIRRNAMKMLISGLVALSVLSGYGASALADKVPQSIWEQLDRDGRGGHLI*
Ga0126380_101527633	3300010043	Tropical Forest Soil	MKTLISALLALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0126380_112794111	3300010043	Tropical Forest Soil	LRRIAIKALFSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0126384_1000011132	3300010046	Tropical Forest Soil	MKALLSALLALSLLSGYAASAFADQAPKSIWDELDRDGRGGHPT*
Ga0126382_100577616	3300010047	Tropical Forest Soil	LRIIAMKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT*
Ga0126382_102954862	3300010047	Tropical Forest Soil	MKMIVSAFLALSVLTGYAASALADKVPPAIWEQLDREGHAS*
Ga0126382_106904981	3300010047	Tropical Forest Soil	MKTLIPALLALSVLLSVLGTLSVLSGYAASALADKVPPSIWEQLDRDGHPG*
Ga0126382_107304343	3300010047	Tropical Forest Soil	ALSVLLGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0126382_110227031	3300010047	Tropical Forest Soil	MKTILSALVALAVLSGSAASALADKVPASIWEQLDREGHSRSS*
Ga0126372_103167682	3300010360	Tropical Forest Soil	MSMKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHAG*
Ga0126372_107052282	3300010360	Tropical Forest Soil	MKTVISALVALSVLSGYAASALADKVPQSIWEQLDREGRGGHPT*
Ga0126377_101100643	3300010362	Tropical Forest Soil	MKIMISALLALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT*
Ga0126377_103660682	3300010362	Tropical Forest Soil	MKTLMSGLVALAVLSASAASALADKVPQSIWEQLDREGHARSN*
Ga0126377_109288162	3300010362	Tropical Forest Soil	MKMVISGLVALSVLSGYGALALADKVPQSIWEQLDRDGRGGRLN*
Ga0126377_128382722	3300010362	Tropical Forest Soil	MKAILSALVTLSVLLGTTAAALADKVPPSIWEQLDRDGHGGRPT*
Ga0126377_130954811	3300010362	Tropical Forest Soil	LMSVLVALAVLSASAAAALADKVPQSIWEQLDREGHGRSN*
Ga0126383_123277552	3300010398	Tropical Forest Soil	MKTIISALVALSVLSGYAASAFADKVPQSIWEQLDRDGRGGHPT*
Ga0134122_100079326	3300010400	Terrestrial Soil	MKTLISAVLALSVLSSYAAAAMADKVPPSIWEQLDRDGRGGHPT*
Ga0124844_13209011	3300010868	Tropical Forest Soil	LVSVLAGLAILSGYAASVLADKVPPSIWEQLDRDGHAG*
Ga0157353_10352553	3300012496	Unplanted Soil	MSALLALSVVSGYAATALADTVPQSIWEQLDREGRGGHPT*
Ga0132258_101360805	3300015371	Arabidopsis Rhizosphere	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVTDLS*
Ga0132258_113764534	3300015371	Arabidopsis Rhizosphere	MKSVISALVALSVLSGYAASAAADKVPQSIWEQLDREGRGGHPT*
Ga0132256_1021233383	3300015372	Arabidopsis Rhizosphere	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAV
Ga0207685_105493502	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVISALLALSVLSGYAASAFADKVPQSIWEELDRDGRGGHPT
Ga0207669_118002251	3300025937	Miscanthus Rhizosphere	MKTVISALVALSALSGYAASAFADKVPQSIWEQLDREGRGGHPT
Ga0207678_117972481	3300026067	Corn Rhizosphere	MKTLISAVLALSVLSSYAAAAMADKVPPSIWEQLDRDGRGGHPT
Ga0207675_1002768723	3300026118	Switchgrass Rhizosphere	MKRIISALLVLSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT
Ga0209466_11083852	3300027646	Tropical Forest Soil	MKTLIPALLALSVLLSVLGALSVLSGYAASALADKVPPSIWEQLDRDGHPG
Ga0209074_101429893	3300027787	Agricultural Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHPT
Ga0207428_100219955	3300027907	Populus Rhizosphere	MKTIMSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT
Ga0207428_103104622	3300027907	Populus Rhizosphere	MKTLICAVVALSVLSGYAASAIADKVPPSIWEQLDRDGRGGHPT
Ga0207428_104142262	3300027907	Populus Rhizosphere	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVSDLS
Ga0207428_104571383	3300027907	Populus Rhizosphere	MSALLALSVVSGYAATAFADTVPQSIWEQLDREGRGGHPT
Ga0307480_10080493	3300031677	Hardwood Forest Soil	MKTIMSALLALSVVSGYAATALADTVPQSIWEQLDRDGHGAVTDLS
Ga0307480_10089594	3300031677	Hardwood Forest Soil	MKTVVSALLALSVLSGYAASAFADKVPQSIWEELDRDGRGGHPT
Ga0307480_10242663	3300031677	Hardwood Forest Soil	MKTVISALVALSVVSGYAASAFADKVPQSIWEQHDRDGRGGHPT
Ga0307469_100688433	3300031720	Hardwood Forest Soil	MKTLLSAFLALSVLSGYAAKAMADKVPPSIWEQLDRDGRGGHPT
Ga0307468_1000424992	3300031740	Hardwood Forest Soil	MKTVICALVVLSIMSGYAASAFADKVPQSIWEQLDREGRGGHPA
Ga0307468_1002622923	3300031740	Hardwood Forest Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDREGRGGHLT
Ga0307473_103787761	3300031820	Hardwood Forest Soil	KTLISALLALSVLTASTASAMADKVPPWIWEQLDRDGHGAVTDLS
Ga0307473_105881683	3300031820	Hardwood Forest Soil	MKTLISALLALSVLTASTASAMADKVPPWIWEQLDRDGHGAVT
Ga0310892_105567133	3300031858	Soil	MKMLISAFLALSVLSGYAASALADKVPPSIWEQLDRDGRGGHPT
Ga0310890_112359412	3300032075	Soil	MKTVISALVALSVLSGYAASAFADKVPQSIWEQLDRDGRGGHPT
Ga0307470_102041401	3300032174	Hardwood Forest Soil	MKTVICALVVLSIMSGYAASAFADKVPQSIWEQLDPEGRGGHPA
Ga0307470_109262272	3300032174	Hardwood Forest Soil	MKTVISALVALSVVSGYAASAFADKVPQSIWEQLDRDGRGGHPT
Ga0307471_1012835923	3300032180	Hardwood Forest Soil	MKTLFSAVLALSVLSSYAAAAMADKVPPSIWEQLDRDGRGGHPT
Ga0307472_1003990862	3300032205	Hardwood Forest Soil	MKTLISALLALSVLTASAASAMADKVPPWIWEQLDRDGHGAVTDLS
Ga0307472_1009131752	3300032205	Hardwood Forest Soil	MSALLALSVVSGYAATALADTVPQSIWEQLDREGRGGHPT
Ga0373950_0117692_196_330	3300034818	Rhizosphere Soil	MKTLICTVVALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT
Ga0373959_0090668_7_117	3300034820	Rhizosphere Soil	VALSVLSGYAASAMADKVPPSIWEQLDRDGRGGHPT