| Basic Information | |
|---|---|
| Family ID | F090927 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDSALLQNLMAGAGSSSQFIGGLVVALLYAVIGLLSAIGSI |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 96.30 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.296 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 10.19 |
| PF05694 | SBP56 | 2.78 |
| PF06823 | DUF1236 | 2.78 |
| PF04752 | ChaC | 1.85 |
| PF14534 | DUF4440 | 1.85 |
| PF03625 | DUF302 | 0.93 |
| PF08484 | Methyltransf_14 | 0.93 |
| PF13417 | GST_N_3 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF13649 | Methyltransf_25 | 0.93 |
| PF00239 | Resolvase | 0.93 |
| PF01638 | HxlR | 0.93 |
| PF07969 | Amidohydro_3 | 0.93 |
| PF06568 | DUF1127 | 0.93 |
| PF08309 | LVIVD | 0.93 |
| PF08028 | Acyl-CoA_dh_2 | 0.93 |
| PF05532 | CsbD | 0.93 |
| PF13191 | AAA_16 | 0.93 |
| PF00072 | Response_reg | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 10.19 |
| COG3703 | Gamma-glutamylcyclotransferase ChaC2 (glutathione degradation) | Inorganic ion transport and metabolism [P] | 1.85 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.93 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.93 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.93 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.93 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.96 % |
| Unclassified | root | N/A | 37.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402I1Z1E | Not Available | 503 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0603484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300000443|F12B_12768773 | Not Available | 599 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10168399 | Not Available | 522 | Open in IMG/M |
| 3300000789|JGI1027J11758_13022137 | Not Available | 632 | Open in IMG/M |
| 3300000955|JGI1027J12803_103617535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 749 | Open in IMG/M |
| 3300000955|JGI1027J12803_105890950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 619 | Open in IMG/M |
| 3300004480|Ga0062592_102135147 | Not Available | 556 | Open in IMG/M |
| 3300004643|Ga0062591_101705653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 639 | Open in IMG/M |
| 3300005328|Ga0070676_10878228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 666 | Open in IMG/M |
| 3300005330|Ga0070690_101633338 | Not Available | 523 | Open in IMG/M |
| 3300005332|Ga0066388_103145338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300005332|Ga0066388_106902634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300005332|Ga0066388_107761096 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005332|Ga0066388_108371889 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005436|Ga0070713_102376332 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005544|Ga0070686_101591119 | Not Available | 553 | Open in IMG/M |
| 3300005547|Ga0070693_101352297 | Not Available | 552 | Open in IMG/M |
| 3300005713|Ga0066905_102226215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300005764|Ga0066903_100601026 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300005764|Ga0066903_105374641 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005764|Ga0066903_106653771 | Not Available | 601 | Open in IMG/M |
| 3300005764|Ga0066903_106694111 | Not Available | 599 | Open in IMG/M |
| 3300006163|Ga0070715_10325925 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300007076|Ga0075435_100854192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300009034|Ga0115863_1816578 | Not Available | 1036 | Open in IMG/M |
| 3300009792|Ga0126374_10902774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300009792|Ga0126374_11091800 | Not Available | 632 | Open in IMG/M |
| 3300010046|Ga0126384_10219323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1518 | Open in IMG/M |
| 3300010046|Ga0126384_10506698 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300010047|Ga0126382_10796180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300010047|Ga0126382_11412599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 635 | Open in IMG/M |
| 3300010358|Ga0126370_12573009 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010359|Ga0126376_12025774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300010366|Ga0126379_10636023 | Not Available | 1156 | Open in IMG/M |
| 3300010373|Ga0134128_12882137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 530 | Open in IMG/M |
| 3300010376|Ga0126381_103063025 | Not Available | 663 | Open in IMG/M |
| 3300010398|Ga0126383_12960944 | Not Available | 555 | Open in IMG/M |
| 3300012349|Ga0137387_11203166 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012948|Ga0126375_10714800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300012971|Ga0126369_12292118 | Not Available | 627 | Open in IMG/M |
| 3300012989|Ga0164305_11801164 | Not Available | 553 | Open in IMG/M |
| 3300015201|Ga0173478_10621171 | Not Available | 565 | Open in IMG/M |
| 3300015372|Ga0132256_102555634 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300016294|Ga0182041_10322268 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300016357|Ga0182032_10533773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 969 | Open in IMG/M |
| 3300016371|Ga0182034_10057594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 2601 | Open in IMG/M |
| 3300016371|Ga0182034_10315824 | Not Available | 1257 | Open in IMG/M |
| 3300016387|Ga0182040_10124176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1796 | Open in IMG/M |
| 3300016387|Ga0182040_11688539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300016422|Ga0182039_10849890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300016445|Ga0182038_10956320 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300016445|Ga0182038_11469696 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300017792|Ga0163161_10367343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1147 | Open in IMG/M |
| 3300018431|Ga0066655_10722159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300019356|Ga0173481_10441765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 648 | Open in IMG/M |
| 3300019890|Ga0193728_1207389 | Not Available | 818 | Open in IMG/M |
| 3300021560|Ga0126371_11536086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300021560|Ga0126371_12131100 | Not Available | 676 | Open in IMG/M |
| 3300026313|Ga0209761_1227744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300027703|Ga0207862_1008658 | Not Available | 2970 | Open in IMG/M |
| 3300027722|Ga0209819_10261453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 599 | Open in IMG/M |
| 3300027874|Ga0209465_10202912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 990 | Open in IMG/M |
| 3300027874|Ga0209465_10258881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300027903|Ga0209488_10205261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1484 | Open in IMG/M |
| 3300027915|Ga0209069_11026937 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028047|Ga0209526_10689940 | Not Available | 644 | Open in IMG/M |
| 3300028720|Ga0307317_10153081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 775 | Open in IMG/M |
| 3300028799|Ga0307284_10271670 | Not Available | 677 | Open in IMG/M |
| 3300030006|Ga0299907_11024985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas qijiaojingensis | 605 | Open in IMG/M |
| 3300031543|Ga0318516_10797498 | Not Available | 533 | Open in IMG/M |
| 3300031713|Ga0318496_10206198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300031719|Ga0306917_10971765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 663 | Open in IMG/M |
| 3300031719|Ga0306917_11239806 | Not Available | 578 | Open in IMG/M |
| 3300031765|Ga0318554_10071878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1918 | Open in IMG/M |
| 3300031768|Ga0318509_10510030 | Not Available | 672 | Open in IMG/M |
| 3300031779|Ga0318566_10239105 | Not Available | 901 | Open in IMG/M |
| 3300031792|Ga0318529_10451486 | Not Available | 598 | Open in IMG/M |
| 3300031833|Ga0310917_10878365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604 | Open in IMG/M |
| 3300031846|Ga0318512_10406626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
| 3300031879|Ga0306919_10030976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3372 | Open in IMG/M |
| 3300031879|Ga0306919_11485265 | Not Available | 510 | Open in IMG/M |
| 3300031890|Ga0306925_10852789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
| 3300031910|Ga0306923_11165539 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031910|Ga0306923_11868162 | Not Available | 614 | Open in IMG/M |
| 3300031912|Ga0306921_11125590 | Not Available | 878 | Open in IMG/M |
| 3300031912|Ga0306921_12205336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 580 | Open in IMG/M |
| 3300031941|Ga0310912_11023100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 633 | Open in IMG/M |
| 3300031942|Ga0310916_11225107 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031942|Ga0310916_11643528 | Not Available | 521 | Open in IMG/M |
| 3300031945|Ga0310913_10264441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
| 3300031945|Ga0310913_10309351 | Not Available | 1115 | Open in IMG/M |
| 3300031946|Ga0310910_10761641 | Not Available | 764 | Open in IMG/M |
| 3300031947|Ga0310909_10032618 | All Organisms → cellular organisms → Bacteria | 3880 | Open in IMG/M |
| 3300031947|Ga0310909_11062336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 659 | Open in IMG/M |
| 3300031947|Ga0310909_11336320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 575 | Open in IMG/M |
| 3300031959|Ga0318530_10490279 | Not Available | 511 | Open in IMG/M |
| 3300032001|Ga0306922_12172642 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032012|Ga0310902_11039586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 570 | Open in IMG/M |
| 3300032044|Ga0318558_10638134 | Not Available | 532 | Open in IMG/M |
| 3300032059|Ga0318533_10891106 | Not Available | 653 | Open in IMG/M |
| 3300032076|Ga0306924_10320620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1777 | Open in IMG/M |
| 3300032090|Ga0318518_10333194 | Not Available | 779 | Open in IMG/M |
| 3300032180|Ga0307471_100489351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1376 | Open in IMG/M |
| 3300032261|Ga0306920_101971183 | Not Available | 819 | Open in IMG/M |
| 3300032892|Ga0335081_10700023 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300033289|Ga0310914_10629715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 966 | Open in IMG/M |
| 3300033290|Ga0318519_10199598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08450160 | 2189573004 | Grass Soil | MDSALLRNLMAGAGSSSQFTGGLVVALLYLVIGLVV |
| ICChiseqgaiiDRAFT_06034842 | 3300000033 | Soil | VESALLKNLMTGAGSSGQFIGGVVVTLLYAVIGLL |
| F12B_127687731 | 3300000443 | Soil | MDSALLQNLLTGAASSSQFIGGXXXXMLYAVIGLLGAIGSIVVFRR |
| AF_2010_repII_A1DRAFT_101683991 | 3300000597 | Forest Soil | MNSALLQDLMAGAGSSSRFIGGLVVALLYAVIGLLSAIGSIV |
| JGI1027J11758_130221371 | 3300000789 | Soil | MRTTLLQNLMAGTGSTSQLVGGFVVALLYAVVGLLSAIGSILVF |
| JGI1027J12803_1036175353 | 3300000955 | Soil | MDAALLKNLLAGAGSTSQFVGGLIIALLYVVVGLL |
| JGI1027J12803_1058909501 | 3300000955 | Soil | MDTALLQNLVAGAGSSSQFIGGLVVAVLYAVVGLLGAIGSIVVFRR |
| Ga0062592_1021351471 | 3300004480 | Soil | MDGALLQNLFAGAGSTSQLVGGLIIALLYVVVGLLGAIGSILV |
| Ga0062591_1017056532 | 3300004643 | Soil | MDSALLQNLMAGAGSSSQFIGGLIVALLYVVIGLLGAIGSIVVFRRI |
| Ga0070676_108782281 | 3300005328 | Miscanthus Rhizosphere | MGSALLQNLTAGAGSSSQFIGGLIVALLYVVIGLLGAIGSIVVFRR |
| Ga0070690_1016333381 | 3300005330 | Switchgrass Rhizosphere | MDSALLQNLIAGAGSSSQFIGGLVVALLYVVIGLLGAIGSIV |
| Ga0066388_1031453381 | 3300005332 | Tropical Forest Soil | MKDVGAMKMESALLKNLLTGAGSSSQFIGGLVVALLYVVIGLLGAIG |
| Ga0066388_1069026341 | 3300005332 | Tropical Forest Soil | LGTALLHNLIAGAGSSSQFVGGLVVAVLYAVVGLLGAIGSILVF |
| Ga0066388_1077610961 | 3300005332 | Tropical Forest Soil | MESALLKNLLTGAGSSSQFIGGLVVALLYVVIGLLGAIGSIL |
| Ga0066388_1083718892 | 3300005332 | Tropical Forest Soil | MDSALLKNLVTGAGSSSQFFGGLVVALLYVVIGVLGAIGSILVFR |
| Ga0070713_1023763321 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSALLQNLMAGAGSSSQFVGGLVVALLYVVIGLLSAIGSIA |
| Ga0070686_1015911192 | 3300005544 | Switchgrass Rhizosphere | MDSALLQNLIAGAGSSSQFIGGLVVALLYVVIGLLGAIGSIVVFRRI |
| Ga0070693_1013522971 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSALLQNLIAGAGSSSQFIGGLVVALLYVVIGLLGAIGSIVVFRR |
| Ga0066905_1022262153 | 3300005713 | Tropical Forest Soil | LDSALLHNLIAGAGSSSQFVGGLVVAVLYAVVGLLGAIGSILVF |
| Ga0066903_1006010261 | 3300005764 | Tropical Forest Soil | MDSALLQNLISGAGSNGQFIGGLVVAMLYVVIGLLG |
| Ga0066903_1053746412 | 3300005764 | Tropical Forest Soil | MRATLLQSLTAGTGSASQLVGGLFVALLYAVVGLLS |
| Ga0066903_1066537712 | 3300005764 | Tropical Forest Soil | MDSALLQSLMAGAGSSSRFIGGLVVALLYAVIGLLSAIGSIVVFRRI |
| Ga0066903_1066941111 | 3300005764 | Tropical Forest Soil | MDSALLKNLVTGAGSSSQFVGGLVVALLYAVIGVLGAIGSILVFR |
| Ga0070715_103259251 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSALLQNLIAGAGSSSQFIGRLVVALLYVVIGLL |
| Ga0075435_1008541922 | 3300007076 | Populus Rhizosphere | MDSALLQNLIAGAGSSSQLIGGLVVALLYFVIGLLG |
| Ga0115863_18165783 | 3300009034 | Sediment, Intertidal | MNAALLQNLIAGAESSSQFIGGLVVLVLYAVVGLLGASMLRSA* |
| Ga0126374_109027741 | 3300009792 | Tropical Forest Soil | MDSALLQNLMAGAGSSGRFIGGLVVALLYAVIGLLSAIGSIVVF |
| Ga0126374_110918001 | 3300009792 | Tropical Forest Soil | MDSALLKNLVTGAGSSSQFIGGLVVALLYLVIGVLGAIGSIIVFR |
| Ga0126384_102193231 | 3300010046 | Tropical Forest Soil | MNSALLQNLITGAGSSSQFIGGLVVAVLYVVIGLLSAIGSILIF |
| Ga0126384_105066982 | 3300010046 | Tropical Forest Soil | MNSALLQNLVAGAGSSSQLIGGLIVAVLYAVIGVLGATGSIL |
| Ga0126382_107961802 | 3300010047 | Tropical Forest Soil | MDSALLQNLMTGAGSSSQFIGGLVVALLYAVIGLLSAIGSIVV |
| Ga0126382_114125991 | 3300010047 | Tropical Forest Soil | LEQKLGSALLHNLIAGAGSSSQFVGGLVVAVLYAVIG |
| Ga0126370_125730091 | 3300010358 | Tropical Forest Soil | MDSTLLRNLTTGAGSSGQFIGGLVVALLYVVIGVLAAIGSILVF |
| Ga0126376_120257742 | 3300010359 | Tropical Forest Soil | MESALLKNLLTGAGSGSQFIGGLVVVLLYVVIGLLGAIG |
| Ga0126379_106360232 | 3300010366 | Tropical Forest Soil | LEQKLDSALLHNLIIGAGSSSQFVGGLVVAVLYAVIGLLGAI |
| Ga0134128_128821371 | 3300010373 | Terrestrial Soil | MQNLMTGTGSSSQLVGGFVVGMLYAVIGLLSAIGSIVV |
| Ga0126381_1030630251 | 3300010376 | Tropical Forest Soil | MDSPLLKNLVAGAGSSSQFIGGLVVAMLYAVIGVLGAVGSILVFRRI |
| Ga0126383_129609442 | 3300010398 | Tropical Forest Soil | MNSALLQNLAAGAGSSSQFIGGLVVALLYVVIGLLSAIGSILIFRRI |
| Ga0137387_112031662 | 3300012349 | Vadose Zone Soil | MNSALLQNLMAGAGSSSQFVGGLVVALLYVVIGLL |
| Ga0126375_107148001 | 3300012948 | Tropical Forest Soil | MDSALLQNLIAGAGSSSQLIGGLVVALLYFVVGLLSAI |
| Ga0126369_122921182 | 3300012971 | Tropical Forest Soil | MDSALLQNLMAGAGSSSRFIGGLVVALLYAVIGLLSAIGSIVVFRR |
| Ga0164305_118011642 | 3300012989 | Soil | MDSALLENLVTGAGSTSQFIGGLVIAFLYGVVGLLGA |
| Ga0173478_106211711 | 3300015201 | Soil | MDSALLQNLMAGAGSSSQFIGGLIVALLYVVIGLL |
| Ga0132256_1025556342 | 3300015372 | Arabidopsis Rhizosphere | MGATKMNSALLQNLMAGAGSSSQFIGGLVVALLYVVIGLLSAIG |
| Ga0182041_103222681 | 3300016294 | Soil | MNSALLQNLVAGAGSSSQFIGGLVVALLYLVVGLLGAIGSILVFRRI |
| Ga0182032_105337732 | 3300016357 | Soil | MNSTLLQNLIVDAESSSQFVGGLVIALLYVVIGLLSAIG |
| Ga0182034_100575941 | 3300016371 | Soil | MNSTLLQSLIADAESSSQFVGGLVIALLYVVIGLLSAIGISYFSANL |
| Ga0182034_103158242 | 3300016371 | Soil | MNSALLQNLMAGAESSSQFIGGLVVALLYVVIGLLSAIGSIAV |
| Ga0182040_101241761 | 3300016387 | Soil | MDSGLLHNLLTGTGSSTQLTGGIVVALLYAVIGLLGAVGSILVVRRM |
| Ga0182040_116885391 | 3300016387 | Soil | MHSTGSTLLQNLIAGTGSNGQFVGGLVVALLYLVIGLLGA |
| Ga0182039_108498901 | 3300016422 | Soil | LDSALLHNLIAGAGSSSHFIGGLVVAVLYAVIGLLGAIGSI |
| Ga0182038_109563201 | 3300016445 | Soil | MDTALLQNLISGAGSTSRLIGGLVVAMLYLVIGLLGAIGSILVFR |
| Ga0182038_114696962 | 3300016445 | Soil | MNSALLQNLMAGAGSSSQFIGGLVVALLYVVIGLLSA |
| Ga0163161_103673431 | 3300017792 | Switchgrass Rhizosphere | VRAALMQNLMTGTGSSSQLVGGFVVGMLYAVIGLLSAIGS |
| Ga0066655_107221591 | 3300018431 | Grasslands Soil | MDSALLQNLLAGAGSSSQFMGGVVVAQSTVVAGLPR |
| Ga0173481_104417652 | 3300019356 | Soil | MDSALLQNLMAGAGSSSQFIGGLIVALLYVVIGLLGA |
| Ga0193728_12073892 | 3300019890 | Soil | MDSALLHSLIAGAGSSSKFIGGLIVAMLYAVIGLLSATGSILVF |
| Ga0126371_115360861 | 3300021560 | Tropical Forest Soil | MDSALLQSLMAGAGSSSRFIGGLVVALLYAVIGLLSAI |
| Ga0126371_121311002 | 3300021560 | Tropical Forest Soil | MMDSGLLHNLLTGTGSSIQLIGGIVVALLYTVIGLLGAVGSI |
| Ga0209761_12277441 | 3300026313 | Grasslands Soil | MNSALLQNLMAGAGSSSQFIGGLVVALLYVVIGLLSAIGSILIFR |
| Ga0207862_10086587 | 3300027703 | Tropical Forest Soil | MDSALLKNLVTGSGSSSQFIGGLVVALLYVVIGVLGAIGSILVF |
| Ga0209819_102614531 | 3300027722 | Freshwater Sediment | VRAALMQNLMTGTGSSSQLVGGFVVGMLYAVIGLLSA |
| Ga0209465_102029121 | 3300027874 | Tropical Forest Soil | MKMESALLKNLLTGAGSSSQFIGGLVVALLYVVIGLLGA |
| Ga0209465_102588811 | 3300027874 | Tropical Forest Soil | LEQKLGSALLHNLIAGAGSSSQFVGGLVVAVLYAVIGSLGAIGSILVFRR |
| Ga0209488_102052613 | 3300027903 | Vadose Zone Soil | MDSALLKHLMAGAGSSSQFVGGLIVALLYVVIGLLSAIGSIV |
| Ga0209069_110269372 | 3300027915 | Watersheds | MDSALLQNLIAGAGSSSQFVGGLVVALLYVVIGLLSAIGSILIF |
| Ga0209526_106899401 | 3300028047 | Forest Soil | MDSALLRNLMTGAGSSSQFIGGLVVALLYVVIGLLSSIGSILIFRRI |
| Ga0307317_101530812 | 3300028720 | Soil | MEKALLQNLMAGAGSSSQFVGGLTVALLYVVIGLLSGIGSILIF |
| Ga0307284_102716702 | 3300028799 | Soil | MEKALLQNLMAGAGSSSQFVGGLTVALLYVVIGLLSGIGSILIFR |
| Ga0299907_110249852 | 3300030006 | Soil | MNAALLQNLVAGAGSSSQLIGGLVVALLYAVIGLLGAIGS |
| Ga0318516_107974981 | 3300031543 | Soil | MVNTALLKNLVTGAGSTSQLIGGLVVAMLYAVVGVLGAIGS |
| Ga0318496_102061984 | 3300031713 | Soil | MDSALLQNLIAGAGSGSRLIGGLVVALLYAVIGLLSAI |
| Ga0306917_109717651 | 3300031719 | Soil | VDSALLQNLMAGAGSSSQFIGGLIVAVLYVVIGLLSAIGSIL |
| Ga0306917_112398062 | 3300031719 | Soil | MDSALLKNLVSGAGSSSQFIGGLVVALLYAVVGLLGAIGS |
| Ga0318554_100718781 | 3300031765 | Soil | MASALLQNLMTGAGSSSRFIGGLVVALLYAVIGLLSAF |
| Ga0318509_105100301 | 3300031768 | Soil | MESALLRNLVAGAGSSSQFIGGLVIALLYVVVGLLGAIGSILVFRRI |
| Ga0318566_102391052 | 3300031779 | Soil | MDSALLKNLVTGAGSSSQFVGGLVVALLYVVIGVL |
| Ga0318529_104514861 | 3300031792 | Soil | LGSALLHNLIAGAGSSSQFIGGLVVAVLYAVIGLLGAIGSILVIVFRRI |
| Ga0310917_108783651 | 3300031833 | Soil | MGSPLLKNLVAGAGSSSQFIGGLVVAMLYAVIGVLG |
| Ga0318512_104066263 | 3300031846 | Soil | MDSALLQNLIAGAGSGSRLIGGLVVALLYAVIGLLSA |
| Ga0306919_100309764 | 3300031879 | Soil | MNSALLQNLMAGAGSSSQFIGGLVVALLYVVIGLLSAI |
| Ga0306919_114852651 | 3300031879 | Soil | MDSTLLRDLMAGAGSSGQFIGGLVVALLYLVIGVL |
| Ga0306925_108527891 | 3300031890 | Soil | VDSALLQNLMVGAGSSSQFIGGLIVAMLYAVVGLLAAVG |
| Ga0306923_111655391 | 3300031910 | Soil | MDSGLLHNLLTGTGSSTQLIGGIVVALLYAVIGLLGA |
| Ga0306923_118681622 | 3300031910 | Soil | MDSALLQNLVAGTGSSNRFIGGLVIALLYVVIGLLSAI |
| Ga0306921_111255901 | 3300031912 | Soil | MDSALLKNLVTGAGSSSQFVGGLVVALLYAVIGVLGAIGSIL |
| Ga0306921_122053361 | 3300031912 | Soil | LDSALLHNLIAGAGSSSQFIGGLVVAVLYTVIGLLGAIGSILVF |
| Ga0310912_110231002 | 3300031941 | Soil | MNSTLLQSLIAGAESSSQFVGGLVIALLYVVIGLLSAIGSILI |
| Ga0310916_112251071 | 3300031942 | Soil | MDPALLQNLVAGAGSSSQFIGGLVIALLYMVIGLLSAIG |
| Ga0310916_116435282 | 3300031942 | Soil | MDSTLLRDLMAGAGSSSQFIGGLVVALLYLVIGVLAAIGS |
| Ga0310913_102644412 | 3300031945 | Soil | LDSALLHSLITGAGSSSQFIGGLVVAVLYAVIGVL |
| Ga0310913_103093513 | 3300031945 | Soil | LGSALLHNLIAGAGSSSQFIGGLVVAVLYAVIGLLGAIGSI |
| Ga0310910_107616412 | 3300031946 | Soil | MDSPLLKNLVAGAGSSSQLIGGLVMAMLYAVIGVLGAVGSILVVRRI |
| Ga0310909_100326181 | 3300031947 | Soil | MDSPLLKNLVAGAGSSSQLIGGLVMAMLYAVIGVLGAV |
| Ga0310909_110623361 | 3300031947 | Soil | MDSTLLQNLIAGAGSSSQFVGGLVVALLYTVIGVLGATGSILVFR |
| Ga0310909_113363202 | 3300031947 | Soil | LDSALLHNLIAGAGSSSQFIGGLVVAVFYTVIGLL |
| Ga0318530_104902791 | 3300031959 | Soil | MDSGLLQNLMAGAGSSSRFIGGLVVALLYAVIGLLSAIGSIVV |
| Ga0306922_121726422 | 3300032001 | Soil | MASGLLHNLLTGAGSSSRLIGGMVVVLLYAVIGLLAAVGSILV |
| Ga0310902_110395861 | 3300032012 | Soil | VRAALMQNLMTGTGSSSQLVGGFVVGMLYAVIGLLSAIGSIVV |
| Ga0318558_106381342 | 3300032044 | Soil | MESALLRNLVAGAGSSSQFIGGLAIALLYVVIGLLG |
| Ga0318533_108911062 | 3300032059 | Soil | MDSPLLKNLVAGAGSSSQFIGGLVVAMLYAVIGVLGAVGSILVFR |
| Ga0306924_103206201 | 3300032076 | Soil | MQTGLGEATGMDSALLKNLMTGSGSSSQFIGGLVVALLYVVIG |
| Ga0318518_103331942 | 3300032090 | Soil | MDSALLKNLVTGAGSSSQFVGGLVVALLYAVIGVLGA |
| Ga0307471_1004893512 | 3300032180 | Hardwood Forest Soil | MESALLKNLLSGAGSSSQFIGGVIVTLLYAVIVLLSAI |
| Ga0306920_1019711831 | 3300032261 | Soil | MDSTLLRNLTTGAGSSGQFIGGLVVALLYAVIGVLG |
| Ga0335081_107000233 | 3300032892 | Soil | MEKALLQNLMAGAGSSSQFIGGLIVALLYAVIGLLSAIGSI |
| Ga0310914_106297151 | 3300033289 | Soil | VDSALLQNLMVGAGSSSQFIGGLIVAMLYAVVGLLAAVGSIVV |
| Ga0318519_101995983 | 3300033290 | Soil | MDSALLQNLMAGAGSSSQFIGGLVVALLYAVIGLLSAIGSI |
| ⦗Top⦘ |