| Basic Information | |
|---|---|
| Family ID | F090926 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LTRIINGVQRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.593 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.852 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 11.27% Coil/Unstructured: 83.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF10082 | BBP2_2 | 15.74 |
| PF09721 | Exosortase_EpsH | 4.63 |
| PF02638 | GHL10 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1649 | Uncharacterized lipoprotein YddW, UPF0748 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01B74XP | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 2189573000|GPBTN7E01EN7JB | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300000956|JGI10216J12902_121982799 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300002075|JGI24738J21930_10085328 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300004157|Ga0062590_100517945 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300004157|Ga0062590_101900869 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300004463|Ga0063356_102208449 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300004479|Ga0062595_100328180 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005093|Ga0062594_101207424 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005175|Ga0066673_10482906 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005178|Ga0066688_10050738 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300005187|Ga0066675_10519076 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005289|Ga0065704_10655146 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005332|Ga0066388_101937549 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005446|Ga0066686_10248394 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300005446|Ga0066686_10308223 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300005468|Ga0070707_101048093 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005545|Ga0070695_101239334 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005553|Ga0066695_10605192 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005554|Ga0066661_10034268 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2825 | Open in IMG/M |
| 3300005576|Ga0066708_10266084 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300005615|Ga0070702_100780515 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005764|Ga0066903_100505227 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300005764|Ga0066903_100603944 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300006163|Ga0070715_10355288 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300006175|Ga0070712_100694493 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300006800|Ga0066660_10571332 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300007255|Ga0099791_10316327 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300007265|Ga0099794_10175634 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300009098|Ga0105245_10398032 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300009098|Ga0105245_12520390 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010038|Ga0126315_11245520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300010043|Ga0126380_10777530 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300010047|Ga0126382_12237924 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010321|Ga0134067_10490624 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010337|Ga0134062_10191611 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300010337|Ga0134062_10275132 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300010358|Ga0126370_10754618 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300010362|Ga0126377_12528882 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010366|Ga0126379_10242705 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300010366|Ga0126379_11541236 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300010371|Ga0134125_10673444 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300010376|Ga0126381_103352366 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010376|Ga0126381_103695481 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010398|Ga0126383_11588522 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012202|Ga0137363_10631756 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300012202|Ga0137363_11311573 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012206|Ga0137380_10164272 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300012208|Ga0137376_11492519 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012209|Ga0137379_10231706 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300012285|Ga0137370_10160415 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300012285|Ga0137370_10652884 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012356|Ga0137371_10093434 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
| 3300012356|Ga0137371_10601405 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012356|Ga0137371_11337574 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012357|Ga0137384_10365417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1195 | Open in IMG/M |
| 3300012469|Ga0150984_120982757 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300012532|Ga0137373_10349736 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012923|Ga0137359_10160067 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300012927|Ga0137416_11192939 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012948|Ga0126375_11645277 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012961|Ga0164302_10045317 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300012961|Ga0164302_10378193 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012971|Ga0126369_12708561 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300013297|Ga0157378_12464156 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300015264|Ga0137403_10334817 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300015356|Ga0134073_10408731 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300015359|Ga0134085_10162295 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300015373|Ga0132257_103205113 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300015374|Ga0132255_101248960 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300015374|Ga0132255_101349112 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300016371|Ga0182034_10310969 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300018431|Ga0066655_10785209 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300018482|Ga0066669_11018482 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300018482|Ga0066669_11592852 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300019789|Ga0137408_1066394 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300019890|Ga0193728_1369844 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300020015|Ga0193734_1067151 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021178|Ga0210408_11318767 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300022534|Ga0224452_1020975 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300022694|Ga0222623_10209212 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300022756|Ga0222622_10904413 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025904|Ga0207647_10244180 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300025915|Ga0207693_10556048 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025922|Ga0207646_11352337 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025930|Ga0207701_11224892 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025939|Ga0207665_10936684 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300026312|Ga0209153_1226452 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300026324|Ga0209470_1344016 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026326|Ga0209801_1300636 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026328|Ga0209802_1255611 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300026536|Ga0209058_1207807 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300026547|Ga0209156_10113551 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300026548|Ga0209161_10443690 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027655|Ga0209388_1049532 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300027748|Ga0209689_1168819 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300027874|Ga0209465_10617243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300028807|Ga0307305_10493456 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300028878|Ga0307278_10042855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2058 | Open in IMG/M |
| 3300028881|Ga0307277_10240902 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031231|Ga0170824_111850396 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031231|Ga0170824_123410604 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300031474|Ga0170818_100786457 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031474|Ga0170818_101295606 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031720|Ga0307469_12385052 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031941|Ga0310912_11260765 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032059|Ga0318533_11369736 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032205|Ga0307472_100696614 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_3515470 | 2040502001 | Soil | RIINGVQRTETINLRQSIHGNPIYPEYVQDGDVIYISRSLFN |
| N55_02186670 | 2189573000 | Grass Soil | IINGEQVTETFNLKPTIHGKVTKPKYVQDGDVIYITRSFF |
| JGI10216J12902_1219827991 | 3300000956 | Soil | GGVSDYGSASNVHLTRIIGGVQRTETINLRQSIHGNPIYPEYVQDGDVIYISRSLF* |
| JGI24738J21930_100853282 | 3300002075 | Corn Rhizosphere | RTETINLRPTIRGHPTKPKYVQDGDVIYIGRSWF* |
| Ga0062590_1005179452 | 3300004157 | Soil | RIINGEQRTETINLRPIIHGEPTKPEYVQDGDVIYISRSWF* |
| Ga0062590_1019008691 | 3300004157 | Soil | RIIAGEERTETINLRPTVKGKPTLPKYVQDGDVIYISRNWF* |
| Ga0063356_1022084492 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FDRPKTVYQAIMDAGGVSDYGSWRNIHLTRIINGVQRTETINLRPVIHGEPIEPEYVQEGDVIYISRSWF* |
| Ga0062595_1003281801 | 3300004479 | Soil | ASNVHLTRIINGQQVTETVNLRPTIHGEPTRPTYVQDGDVIYVGRSWF* |
| Ga0062594_1012074241 | 3300005093 | Soil | IINGLQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF* |
| Ga0066673_104829061 | 3300005175 | Soil | TRIINGVQRTETVNLRPAIHGQPVRPEYVQDGDVIYIARSLF* |
| Ga0066688_100507383 | 3300005178 | Soil | SDYGSPSNIHLTRVINGVQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF* |
| Ga0066675_105190762 | 3300005187 | Soil | YGSASSIHLTRIIDGVQLTETINLRPTIHGKPTRPKYVQDGDVIYIARNWF* |
| Ga0065704_106551461 | 3300005289 | Switchgrass Rhizosphere | LTRIINGVQRTETINLRPVIHGEPIEPEYVQDGDVIYISRSWF* |
| Ga0066388_1019375492 | 3300005332 | Tropical Forest Soil | SPSNIHLTRIIDGEQRTEFINLRPAIHGQPVRPEYVQDGDVIYIARSLF* |
| Ga0066686_102483942 | 3300005446 | Soil | RIINGVQRTETINLRQSIRGKPLYPEYVQDGDVIYVSRSLF* |
| Ga0066686_103082232 | 3300005446 | Soil | SNIHLTRIINGEQRTETINLRPTIHGHPTKPKYVQDGDVIYISRSLF* |
| Ga0070707_1010480931 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRIINGAQLTESINLRATIRGKPTKPKYVEDGDVIYIARSWF* |
| Ga0070695_1012393342 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NIHLTRVINGEQLTETFSLKPSIRGEPVKPKYVQDGDVIYIGRSLF* |
| Ga0066695_106051922 | 3300005553 | Soil | QRSETVNLRPTIRGEPTKPTYVEDGDVIYISRSLF* |
| Ga0066661_100342683 | 3300005554 | Soil | IHLTRIINGVQRTERINLRPSIRGKPIQPKYVQDGDVIYIARSLF* |
| Ga0066708_102660842 | 3300005576 | Soil | LTRIINGVQRTETINLRPNIRGKPTNPEYVQDGDVIYIARSLF* |
| Ga0070702_1007805152 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IRIINGEQRVEIFSLRPTIRGEPTQPKYVKDGDVIYVSRSLL* |
| Ga0066903_1005052271 | 3300005764 | Tropical Forest Soil | NGVQQTERINLRPSIHGEPTQPKYVQDGDVIYIARSLF* |
| Ga0066903_1006039441 | 3300005764 | Tropical Forest Soil | SNIHLTRIINGVQRTESLNLKPSIRGQPVEPEYVQDGDVIYIGRSLF* |
| Ga0070715_103552881 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TRIINGLQRTETINLRPAIRGEPINPKYIQDGDVIYISRSLF* |
| Ga0070712_1006944931 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QLTETINLRPSIHGQPIYPKYVQDGDVIYISRSLF* |
| Ga0066660_105713321 | 3300006800 | Soil | IIDGVQLTETINLRPTIHGKPTRPKYVQDGDVIYIARNWF* |
| Ga0099791_103163271 | 3300007255 | Vadose Zone Soil | SSVHLTRIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARSWF* |
| Ga0099794_101756341 | 3300007265 | Vadose Zone Soil | INGEQRTEVINLRPTVHGKPTIPKYVQDGDVIYISRNWF* |
| Ga0105245_103980321 | 3300009098 | Miscanthus Rhizosphere | IINGEQRTETINLRPTIRGHPTKPKYVQDGDVIYIGRSWF* |
| Ga0105245_125203901 | 3300009098 | Miscanthus Rhizosphere | RIINGVQLTETINLRPSIHGQPIYPKYVQDGDVIYISRSLF* |
| Ga0126315_112455201 | 3300010038 | Serpentine Soil | ASNIHLTRIIDGKQLSETINLRPAIHGQPVKPEYVQDGDVIYIGRSLF* |
| Ga0126380_107775301 | 3300010043 | Tropical Forest Soil | VQRTERINLRPSIHGEPLYPKYVQDGDVIYISRSLF* |
| Ga0126382_122379241 | 3300010047 | Tropical Forest Soil | RIIDGVQRTETINLRPSIRGKTIQPEYVKDGDVIYISRSLF* |
| Ga0134067_104906241 | 3300010321 | Grasslands Soil | VHLTRIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARNWF* |
| Ga0134062_101916112 | 3300010337 | Grasslands Soil | LTRIINGVQRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF* |
| Ga0134062_102751321 | 3300010337 | Grasslands Soil | SNIHLTRIINGEQRTEMINLRPSIHGEPTKPKYVQDGDVVYISRSLF* |
| Ga0126370_107546182 | 3300010358 | Tropical Forest Soil | ASNIRLTRIINGVQRAETINLRKSIHGTPVYPEYVKDGDVIYLARSLF* |
| Ga0126377_125288822 | 3300010362 | Tropical Forest Soil | INGEQRTETINLRPSIHGEPTQPKYVQDGDVIYIARSLF* |
| Ga0126379_102427053 | 3300010366 | Tropical Forest Soil | VSDYGSASNIHLTRIVDGVQRTERINLRPSIHGEALYPKYVQDGDVIYISRSLF* |
| Ga0126379_115412361 | 3300010366 | Tropical Forest Soil | IINGVQQTERINLRPSIRGQLTQPKYVQDGDVIYISRSLF* |
| Ga0134125_106734442 | 3300010371 | Terrestrial Soil | VSDYGSASNIHLTRIINGVQLTETINLRPSIHGQPIYPKYVQDGDVIYILRSLFLPVVPAGRDLQT* |
| Ga0126381_1033523661 | 3300010376 | Tropical Forest Soil | RTETFNLKPTLHGHTTKPKYVQDGDVIYISRSFF* |
| Ga0126381_1036954811 | 3300010376 | Tropical Forest Soil | SASSVHLTRIIDGVQRTETINLRTAILGQPLRPEYVQEGDVIYIARSLF* |
| Ga0126383_115885221 | 3300010398 | Tropical Forest Soil | SDYGSASNIHLTRIIDGVQRTERINLRPSIHGEPLYPKYVQDGDVIYISRSLF* |
| Ga0137363_106317561 | 3300012202 | Vadose Zone Soil | QRSETVNLRPTIRGESTKPTYVEDGDVIYISRSLF* |
| Ga0137363_113115731 | 3300012202 | Vadose Zone Soil | LSNVHLTRMINGEQRTEVINLRPTVHGKPTLPIYVQDGDVIYISRNWF* |
| Ga0137380_101642721 | 3300012206 | Vadose Zone Soil | GEQRTETINLRPTIHGKPTKPKYVQDGDVIYISRSWF* |
| Ga0137376_114925191 | 3300012208 | Vadose Zone Soil | RTETINLRPAIRGEPINPKYVQDGDVIYISRSLF* |
| Ga0137379_102317063 | 3300012209 | Vadose Zone Soil | TRIINGVQVTETINLKPSIRGQPTQPKYVQDGDVIYISRSLF* |
| Ga0137370_101604151 | 3300012285 | Vadose Zone Soil | NVHLTRIINGEQRTETINLRPTIHGHPTKPKYVQDGDVIYISRSLF* |
| Ga0137370_106528841 | 3300012285 | Vadose Zone Soil | SASNIHLTRIIDGIEQTETINLRPAIHGQLTKPKYVRDGDVIYISRSWF* |
| Ga0137371_100934341 | 3300012356 | Vadose Zone Soil | IHLTRIINGEQRTETINLRPTVHGEPTLPTYVQDGDVIYISRSWF* |
| Ga0137371_106014051 | 3300012356 | Vadose Zone Soil | QRTETLSLKPTIRGNPTKPKYVQDGDVIYISRSLF* |
| Ga0137371_113375741 | 3300012356 | Vadose Zone Soil | YGSPSNVHLTRIINGEQRTETINLRSAIRGTPIKPKYVQDGDVIYIARSWF* |
| Ga0137384_103654171 | 3300012357 | Vadose Zone Soil | IDGVQRTETINLRPNIRGKPTNPKYVQDGDVIYISRSWF* |
| Ga0150984_1209827571 | 3300012469 | Avena Fatua Rhizosphere | SNIHLTRIINGVQRTESLNLRPSIRGQPVQPEYVQDGDVIYIGRSLF* |
| Ga0137373_103497361 | 3300012532 | Vadose Zone Soil | VQRTETINLRQSIRGKPLYPEYVQDGDVIYVSRSLF* |
| Ga0137359_101600673 | 3300012923 | Vadose Zone Soil | IHLTRIIKGEQRTETLNLRPTIHGNPTKPKYVQDGDVIYISRSWF* |
| Ga0137416_111929392 | 3300012927 | Vadose Zone Soil | HLTRIINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARSWF* |
| Ga0126375_116452771 | 3300012948 | Tropical Forest Soil | TRIIDGVQRTETINLRPSIRGKTIQPEYVKDGDVIYISRSLF* |
| Ga0164302_100453171 | 3300012961 | Soil | SNIHLTRIINGLQRTETINLRPAIRGELINPKYIQDGDVIYISRSLF* |
| Ga0164302_103781931 | 3300012961 | Soil | NGVQRTESLNLKPSIRGQPVHPAYVQDGDVIYIGRSLL* |
| Ga0126369_127085612 | 3300012971 | Tropical Forest Soil | DYGSASNIHLTRIIDGVQRTERINLRPSIHGNPVYPKYVQDGDVIYISRSLF* |
| Ga0157378_124641562 | 3300013297 | Miscanthus Rhizosphere | INGLQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF* |
| Ga0137403_103348171 | 3300015264 | Vadose Zone Soil | LSNVHLTRIINGEQRTEVINLRPTVHGKPTIPKYVQDGDVIYISRNWF* |
| Ga0134073_104087312 | 3300015356 | Grasslands Soil | EQRTETINLRPSIRGKPIQPKYVQDGDVIYISRSLF* |
| Ga0134085_101622952 | 3300015359 | Grasslands Soil | NGEQRTETINLRPTIRGQPTKPKYVQDGDVIYISRSLF* |
| Ga0132257_1032051132 | 3300015373 | Arabidopsis Rhizosphere | YQAIMEAGGVSDYGSASNVHLTRIINGVQRTETINLRQSIRCTPPIYPEYVQDGDVIYSSRSLF* |
| Ga0132255_1012489602 | 3300015374 | Arabidopsis Rhizosphere | VSDYGSASNVHLTRIIDGKQLTETVNLRPAIHGQPVRPEYVQDGDVIYIARSLF* |
| Ga0132255_1013491121 | 3300015374 | Arabidopsis Rhizosphere | LTRIINGVQRTETINLKPTVHGKVTIPKYVQDGDVIYISRSWF* |
| Ga0182034_103109692 | 3300016371 | Soil | IINGVQRTESLNLKPSIRGQPVQPEYVQDGDVIYIGRSLF |
| Ga0066655_107852092 | 3300018431 | Grasslands Soil | IINEVPRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF |
| Ga0066669_110184821 | 3300018482 | Grasslands Soil | NGVPRTEAINLRPMIHGHPTKPKYGQDGDVIYIARSLF |
| Ga0066669_115928521 | 3300018482 | Grasslands Soil | GEQRTETINLRPTVHGKPTIPKYVQDGDVIYISRNWF |
| Ga0137408_10663942 | 3300019789 | Vadose Zone Soil | SNIHLTRIINGVQRTERINLRPSIHGQPVNPKYVQDGDVIYIARSLF |
| Ga0193728_13698441 | 3300019890 | Soil | GEQRTETLNLKPAIRGEPTKPKYVQDGDVIYISRSLF |
| Ga0193734_10671512 | 3300020015 | Soil | INGVQRTETINLRPSIRGTPIYPEYVQDGDVIYISRSLF |
| Ga0210408_113187671 | 3300021178 | Soil | INGVQRTETINLRPNIRGKPTNPKYVQDGDVIYISRSLF |
| Ga0224452_10209753 | 3300022534 | Groundwater Sediment | SASNVHLTRIINGVQRTETLNLRQSIHGNPVYPEYVQDGDVIYISRSLF |
| Ga0222623_102092121 | 3300022694 | Groundwater Sediment | IHGAQRTETINLRPTIHGYPTEPKYVQDGDVIYVSRSWF |
| Ga0222622_109044132 | 3300022756 | Groundwater Sediment | GVQRSETVNLRPTIRGESTKPTYVEDGDVIYISRSLF |
| Ga0207647_102441802 | 3300025904 | Corn Rhizosphere | GEQRTETINLRPTIRGHPTKPKYVQDGDVIYIGRSWF |
| Ga0207693_105560481 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QLTETINLRPSIHGQPIYPKYVQDGDVIYISRSLF |
| Ga0207646_113523371 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GSPSNIHLTRIINGAQLTESINLRATIRGKPTKPKYVEDGDVIYIARSWF |
| Ga0207701_112248921 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SDYGSASNIHLTRIINGEQLSETINLRPDIHGYPVRPEYVQDGDVIYIGRSLF |
| Ga0207665_109366841 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ASNIHLTRIINGLQRTETINLRPAIRGEPINPKYIQDGDVIYISRSLF |
| Ga0209153_12264521 | 3300026312 | Soil | NGVQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF |
| Ga0209470_13440162 | 3300026324 | Soil | SNIHLTRIINGEQRTETINLRPTIRGTPIKPKYVQDGDVIYIARSWF |
| Ga0209801_13006362 | 3300026326 | Soil | IINGEQRTEMINLRASIRGEPTKPKYVQDGDVIYIARSLF |
| Ga0209802_12556111 | 3300026328 | Soil | SNIHLTRIINGVQRTERINLRPSIRGKPIQPKYVQDGDVIYIARSLF |
| Ga0209058_12078071 | 3300026536 | Soil | QRTETINLRPTIHGHPTKPKYVQDGDVIYISRSLF |
| Ga0209156_101135512 | 3300026547 | Soil | VIDGVQLTETINLRPSIHGKPIYPKYVQDGDVIYISRSLF |
| Ga0209161_104436901 | 3300026548 | Soil | IIDGVQLTETINLRPTIHGKPTRPKYVQDGDVIYIARNWF |
| Ga0209388_10495321 | 3300027655 | Vadose Zone Soil | IINGVQRTETINLRPTIHGKPTEPKYVQDGDVIYIARSWF |
| Ga0209689_11688191 | 3300027748 | Soil | SNIHLTRIVNGAQLTESINLRPAIHGQPVRPEYVQDGDVIYIARSLF |
| Ga0209465_106172431 | 3300027874 | Tropical Forest Soil | YGSASNIHLTRIINGVQYTERINLRPSIHGQPVDPEYVQDGDVIYISRSLF |
| Ga0307305_104934561 | 3300028807 | Soil | QRSETVNLRPTIRGEPTKPTYVEDGDVIYISRSLF |
| Ga0307278_100428553 | 3300028878 | Soil | LTRIINGVQRTETINLRQSIRGKPLYPEYVQDGDVIYVSRSLF |
| Ga0307277_102409022 | 3300028881 | Soil | QRTETINLRPSIRGQPIYPEYVQDGDVIYISRSLF |
| Ga0170824_1118503961 | 3300031231 | Forest Soil | QRTETINLRPAIRGEPINPKYVQDGDVIYISRSLF |
| Ga0170824_1234106042 | 3300031231 | Forest Soil | VSDFGSASNIHLTRIIDGKQLTESINLKPAIKGQPLRPEYVQDGDVIYIGRSLF |
| Ga0170818_1007864571 | 3300031474 | Forest Soil | GVQFTETFNLKPTIHGHPTKPEYVQDGDVIYISRSFF |
| Ga0170818_1012956062 | 3300031474 | Forest Soil | INGEQRTETINLRPTVHGKPTIPEYVQDGDVIYISRNWF |
| Ga0307469_123850521 | 3300031720 | Hardwood Forest Soil | DYGSASNVHLTRIINGVQRTETINLRQSIRGKPIYPEYVQDGDVIYISRSLF |
| Ga0310912_112607651 | 3300031941 | Soil | NIHLTRLINGVQRTESLNLKPSIRGQPLQPEYVQDGDVIYIGRSLF |
| Ga0318533_113697362 | 3300032059 | Soil | IHLTRIIYGVQRTESLNLKPSIRGKPVQPEYVQDGDVIYIGRSLF |
| Ga0307472_1006966142 | 3300032205 | Hardwood Forest Soil | LTRIINGEQRTETINLRPAVHGKPTLPKYVQDGDVIYISRNWF |
| ⦗Top⦘ |