NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090892

Metagenome / Metatranscriptome Family F090892

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090892
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 109 residues
Representative Sequence MRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Number of Associated Samples 76
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 34.26 %
% of genes near scaffold ends (potentially truncated) 34.26 %
% of genes from short scaffolds (< 2000 bps) 58.33 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.185 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(25.926 % of family members)
Environment Ontology (ENVO) Unclassified
(78.704 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.889 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.77%    β-sheet: 11.68%    Coil/Unstructured: 52.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF13203DUF2201_N 43.52
PF00004AAA 8.33
PF13394Fer4_14 3.70
PF05426Alginate_lyase 2.78
PF027395_3_exonuc_N 2.78
PF13186SPASM 1.85
PF10902WYL_2 1.85
PF04055Radical_SAM 1.85
PF07728AAA_5 0.93
PF02954HTH_8 0.93
PF13353Fer4_12 0.93
PF01713Smr 0.93
PF03407Nucleotid_trans 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 2.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.59 %
UnclassifiedrootN/A7.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10037506All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402574Open in IMG/M
3300000928|OpTDRAFT_10035592All Organisms → cellular organisms → Bacteria19166Open in IMG/M
3300000928|OpTDRAFT_10077202All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240987Open in IMG/M
3300000928|OpTDRAFT_10077203All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240816Open in IMG/M
3300000930|BpDRAFT_10138424All Organisms → Viruses → Predicted Viral1278Open in IMG/M
3300000930|BpDRAFT_10149610All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402097Open in IMG/M
3300001460|JGI24003J15210_10088113All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240919Open in IMG/M
3300001846|ACM22_1022334All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1170Open in IMG/M
3300004097|Ga0055584_100223434All Organisms → cellular organisms → Bacteria → Proteobacteria1917Open in IMG/M
3300005837|Ga0078893_11787888All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401031Open in IMG/M
3300005942|Ga0070742_10064107All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401001Open in IMG/M
3300006164|Ga0075441_10005068All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405856Open in IMG/M
3300006164|Ga0075441_10005123All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405824Open in IMG/M
3300006164|Ga0075441_10027212All Organisms → Viruses → Predicted Viral2335Open in IMG/M
3300006191|Ga0075447_10073905All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401213Open in IMG/M
3300006352|Ga0075448_10049784All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401339Open in IMG/M
3300006352|Ga0075448_10060709All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401203Open in IMG/M
3300006352|Ga0075448_10107166All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240874Open in IMG/M
3300006752|Ga0098048_1000236Not Available28178Open in IMG/M
3300006752|Ga0098048_1002568All Organisms → cellular organisms → Bacteria7596Open in IMG/M
3300006789|Ga0098054_1196607All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240736Open in IMG/M
3300006793|Ga0098055_1030959All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402220Open in IMG/M
3300006922|Ga0098045_1010651All Organisms → cellular organisms → Bacteria2610Open in IMG/M
3300006947|Ga0075444_10078625All Organisms → Viruses → Predicted Viral1483Open in IMG/M
3300006947|Ga0075444_10081417All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300006947|Ga0075444_10117137All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401147Open in IMG/M
3300006947|Ga0075444_10216504All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240767Open in IMG/M
3300006947|Ga0075444_10413627All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240505Open in IMG/M
3300006990|Ga0098046_1016866All Organisms → cellular organisms → Bacteria → Proteobacteria1892Open in IMG/M
3300007962|Ga0102907_1131339All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240647Open in IMG/M
3300008052|Ga0102893_1102617All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240848Open in IMG/M
3300008961|Ga0102887_1200850All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240609Open in IMG/M
3300009024|Ga0102811_1416778All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240509Open in IMG/M
3300009420|Ga0114994_10034591All Organisms → Viruses → Predicted Viral3524Open in IMG/M
3300009428|Ga0114915_1004216All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405814Open in IMG/M
3300009436|Ga0115008_10017309All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405861Open in IMG/M
3300009436|Ga0115008_10021840Not Available5183Open in IMG/M
3300009599|Ga0115103_1561890All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401621Open in IMG/M
3300009599|Ga0115103_1703201All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2403478Open in IMG/M
3300009606|Ga0115102_10320989All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300009606|Ga0115102_10530367All Organisms → cellular organisms → Bacteria8173Open in IMG/M
3300009606|Ga0115102_10587243All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240584Open in IMG/M
3300009677|Ga0115104_11300047All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405666Open in IMG/M
3300010149|Ga0098049_1000090All Organisms → cellular organisms → Bacteria32415Open in IMG/M
3300012413|Ga0138258_1062971All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401100Open in IMG/M
3300017706|Ga0181377_1000013All Organisms → cellular organisms → Bacteria105939Open in IMG/M
3300017706|Ga0181377_1001692All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2407012Open in IMG/M
3300017706|Ga0181377_1011419All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402115Open in IMG/M
3300017725|Ga0181398_1108597All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240661Open in IMG/M
3300017728|Ga0181419_1172496All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240513Open in IMG/M
3300017735|Ga0181431_1040087All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401067Open in IMG/M
3300017758|Ga0181409_1062994All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401131Open in IMG/M
3300017772|Ga0181430_1184207All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240599Open in IMG/M
3300017772|Ga0181430_1184208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240599Open in IMG/M
3300020335|Ga0211690_1014132All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402171Open in IMG/M
3300020438|Ga0211576_10253214All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240924Open in IMG/M
3300021068|Ga0206684_1232437All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240587Open in IMG/M
3300021084|Ga0206678_10249614All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240866Open in IMG/M
3300021085|Ga0206677_10000057All Organisms → cellular organisms → Bacteria91045Open in IMG/M
3300021085|Ga0206677_10001026All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED24026286Open in IMG/M
3300021085|Ga0206677_10001485All Organisms → cellular organisms → Bacteria21665Open in IMG/M
3300021085|Ga0206677_10002437Not Available16292Open in IMG/M
3300021085|Ga0206677_10008234All Organisms → cellular organisms → Bacteria → PVC group7617Open in IMG/M
3300021350|Ga0206692_1432018All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240972Open in IMG/M
3300021359|Ga0206689_10433346All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401142Open in IMG/M
3300024183|Ga0228603_1047041All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240655Open in IMG/M
3300024226|Ga0228667_1061035All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240720Open in IMG/M
(restricted) 3300024264|Ga0233444_10019377All Organisms → cellular organisms → Bacteria → Proteobacteria4889Open in IMG/M
(restricted) 3300024264|Ga0233444_10317116All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240667Open in IMG/M
3300024326|Ga0228652_1057419All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240987Open in IMG/M
3300024329|Ga0228631_1051370All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401112Open in IMG/M
3300025070|Ga0208667_1035593All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240865Open in IMG/M
3300025084|Ga0208298_1003155All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405189Open in IMG/M
3300025098|Ga0208434_1002535Not Available6622Open in IMG/M
3300025120|Ga0209535_1013986All Organisms → Viruses → Predicted Viral4333Open in IMG/M
3300025276|Ga0208814_1000077Not Available76644Open in IMG/M
3300026504|Ga0247587_1114092All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240665Open in IMG/M
3300026505|Ga0228647_1098287All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240699Open in IMG/M
3300027233|Ga0208678_1088174Not Available596Open in IMG/M
3300027413|Ga0208950_1029055All Organisms → cellular organisms → Bacteria → Proteobacteria1514Open in IMG/M
3300027506|Ga0208973_1003865All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2405756Open in IMG/M
3300027506|Ga0208973_1047650All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401125Open in IMG/M
3300027668|Ga0209482_1001666All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED24014767Open in IMG/M
3300027668|Ga0209482_1004107Not Available8169Open in IMG/M
3300027668|Ga0209482_1009450All Organisms → Viruses → Predicted Viral4775Open in IMG/M
3300027668|Ga0209482_1099708All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240933Open in IMG/M
3300027686|Ga0209071_1108377All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240809Open in IMG/M
3300027686|Ga0209071_1187891All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240579Open in IMG/M
3300027704|Ga0209816_1068374All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300027704|Ga0209816_1245455All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240567Open in IMG/M
3300027813|Ga0209090_10009500Not Available5892Open in IMG/M
3300027813|Ga0209090_10026385All Organisms → Viruses → Predicted Viral3364Open in IMG/M
3300027833|Ga0209092_10000033All Organisms → cellular organisms → Bacteria109013Open in IMG/M
3300027833|Ga0209092_10264873All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240941Open in IMG/M
3300028134|Ga0256411_1015592All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402241Open in IMG/M
3300028137|Ga0256412_1124069All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240947Open in IMG/M
3300028414|Ga0228627_1006481All Organisms → cellular organisms → Bacteria4628Open in IMG/M
3300028418|Ga0228615_1076229All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240956Open in IMG/M
3300031140|Ga0308024_1012607All Organisms → Viruses → Predicted Viral2521Open in IMG/M
3300031143|Ga0308025_1025271All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402352Open in IMG/M
3300031599|Ga0308007_10075936All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401251Open in IMG/M
3300031602|Ga0307993_1009340All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2402564Open in IMG/M
3300031608|Ga0307999_1039755All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED2401128Open in IMG/M
3300031660|Ga0307994_1221315All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240589Open in IMG/M
3300031675|Ga0302122_10061553All Organisms → cellular organisms → Bacteria → Proteobacteria1671Open in IMG/M
3300031688|Ga0308011_10138707All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240739Open in IMG/M
3300031766|Ga0315322_10004026All Organisms → cellular organisms → Bacteria11301Open in IMG/M
3300031774|Ga0315331_10742089All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED240690Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.30%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.26%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater8.33%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.48%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.56%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.63%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine4.63%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.78%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.85%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.85%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.93%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.93%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.93%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001846Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25bEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300021084Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024226Seawater microbial communities from Monterey Bay, California, United States - 81DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028414Seawater microbial communities from Monterey Bay, California, United States - 33DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1003750653300000101MarineMRSTYITPKLSEGETVDLSLYSPRERTNIRLYGLNFKDATPADIFEYKNRWKAQSTKITIRGKLSLAQKWCRTHCFHQDFEIHKYANNDDSHAVYFKNPEEAMLFKLSI*
OpTDRAFT_10035592133300000928Freshwater And MarineMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGRYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG*
OpTDRAFT_1007720223300000928Freshwater And MarineLRSISQGTDVWCLMRNTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI*
OpTDRAFT_1007720313300000928Freshwater And MarineMRSTYITPKLSEGETVDLSLYSPRERTNIRLYGLNFKDATPADIFEYKNRWKAQSTKITIRGKLSLAQKWCRTHCFHQDFEIQKYANNDDSHAVYFKNQEEAMLFKLSI*
BpDRAFT_1013842423300000930Freshwater And MarineMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI*
BpDRAFT_1014961013300000930Freshwater And MarineVDLSLYSPRERTNIRLYGLNFKDATPADIFEYKNRWKAQSTKITIRGKLSLAQKWCRTHCFHQDFEIQKYANNDDSHAVYFKNQEEAMLFKLSI*
JGI24003J15210_1008811323300001460MarineMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNRWKAESTKVSIRGRLTIAQRWCKTNCFHQDFEIQKYANNDDSHAIYFKNPEEAMLFKLSI*
ACM22_102233423300001846Marine PlanktonMVDSYLTPKLKEGEKVDLSLYSPRERTNIRLYGLAFKDFTPQMIYEYKRQWAPTCETVNIRGGLEQAKKWCRTYLYHQDFTIIKFANPDDSHSIHFKNAEDAMLFRLSFNA*
Ga0055584_10022343423300004097Pelagic MarineMRNTYITPKLREGETVDLSLYSPRQRTNIRLYGLDFKDALPVDIFEYKTKWKYTATKVDIRGKLSVAQKWCKTNCFHQDFEIQKYANPDDSHAVFFKNPEEAMLFKLSI*
Ga0078893_1178788813300005837Marine Surface WaterTDVWCLMRNTYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNTWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPKEAMLFKLSI*
Ga0070742_1006410713300005942EstuarineMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGRYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG*
Ga0075441_1000506823300006164MarineMRNTYLTPKLREGETVDLSLYSPRERTNIRLYGLDFKNATPADIFEYKTKWSPTATEVSLRGGLDKATRWCRTHCFQQDFKIKKYAKSDDSHIVYFKNAEEAMLFRLSN*
Ga0075441_1000512353300006164MarineMNILDVMVDSYLTPKLEEGETVNLSLYNPRQRTNIRLYGLKCKDWTPLDIFDYKHKWLAEEHEELRIDPDRLTQAAKWCKTNLFHQDFTINKFASPDDSHMILFKNSAEAMLFRLSING*
Ga0075441_1002721243300006164MarineMNTLDVMVDSYLTPKLEEGESLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKRKWAGNCETVTVRGQLDTATKWCRSHCFHQDFTIQKYANPDDSHSIHFKNAEEALLFRLSIG*
Ga0075447_1007390523300006191MarineMNTLHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKREWAPHCETVSVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG*
Ga0075448_1004978423300006352MarineMNTLHVMVDSYLTPRLEEGETVDLSLYPPRQRTNIRLYGLAFKDHTPHMIADYKRKWKSSRETVRIRGRLDKSTKWCKTNCFHQDFIIEKFAYPDDTHAIHFKN
Ga0075448_1006070923300006352MarineMNILDVMVDSYLTPKLEEGERLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKTKWASNCETVTIRGRLDTATKWCRKNCFHQDFTIQKYANPDDSHSI
Ga0075448_1010716623300006352MarineMNTSHVMVDSYLTPRLEEGETIDLSLYPPRQRTNIRLYGLAFKDHTPLMISDYKRKWKSKRETVRIKAKLDVATKWCRTNCFHQDFIIEKFAYPDDTHAIHFKNEEEAMLFRLAIG*
Ga0098048_100023623300006752MarineMSTLDDMVDSYLTPKLKEGESVDLSLYSPRERTNIRLYGLAFKDYTPQMLWEYKRSWAPNCETVVIRSGLDRAKKWCRTHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSFNG*
Ga0098048_1002568153300006752MarineMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDAVPQDIFEYKTKWRKDATEVTIRGRLDKATRWCRTHCFQQDYVIKKYANQDDSHAIYFKNPEEAMLFKLSI*
Ga0098054_119660723300006789MarineMRSPYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNTWKHTATKVDIRGKLSIAQRWCRSNCFQQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI*
Ga0098055_103095953300006793MarineDLSLYSPRERTNIRLYGLAFKDYTPQMLWEYKRSWAPNCETVVIRSGLDRAKKWCRTHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSFNG*
Ga0098045_101065123300006922MarineMRSPYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDAIPADIFEYKTKWRKDATEVTIRGRLDKATRWCRTHCFQQDYVIKKYANQDDSHAIYFKNPEEAMLFKLSI*
Ga0075444_1007862523300006947MarineMNTLDVMVDSYLTPKLEEGESLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKRKWAGNCETVTVRGQLDTAKKWCRSHCFHQDFTIQKYANPDDSHSIHFKNAEEALLFRLSIG*
Ga0075444_1008141723300006947MarineMNILDVMVDSYLTPKLEEGERLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKTKWASNCETVTIRGRLDTATKWCRKNCFHQDFTIQKYANPDDSHSIHFKNPEEALLFKLSIG*
Ga0075444_1011713723300006947MarineMNTLHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKREWAPHCETVSIRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG*
Ga0075444_1021650423300006947MarineHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLAFKDHTPHMIADYKRKWKSSRETVRIRGRLDKSTKWCKTNCFHQDFIIEKFAYPDDTHAIHFKNKEEAMLFRLSIG*
Ga0075444_1041362723300006947MarineMNTLHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKRKWAPHCETVSIRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG*
Ga0098046_101686623300006990MarineMRSSYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDAIPADIFEYKNTWKHTATKVDIRGKLSIAQRWCRSNCFQQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI*
Ga0102907_113133913300007962EstuarineMRSTYITPKLSEGETVDLSLYSPRERTNIRLYGLKFKDATPADIFEYKNRWKAQSTKITIRGKLSLAQKWCRTHCFHQDFEIQKYANNDDSHAVYFKN
Ga0102893_110261723300008052EstuarineLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGRYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG*
Ga0102887_120085013300008961EstuarineMRNTYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDAIPADISEYKTKWRKNATEITIRGQLDKATRWCRTNCYHQDFIIKKYANPDDSHAV
Ga0102811_141677813300009024EstuarineSVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGRYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG*
Ga0114994_1003459173300009420MarineSLYPPRERTNIRLYGVAFKDYTPQMIFEYKRKWASDCETITIRGKLDTATKWCRSHCFHQDFTIQKYANPDDSHSIHFKNAEEAMLFRLAIG*
Ga0114915_100421643300009428Deep OceanLTPKLEEGETVNLSLYNPRQRTNIRLYGLKCKDWTPLDIFDYKHKWLAEEHEELRIDPDRLTQAAKWCKTNLFHQDFTINKFASPDDSHMILFKNSAEAMLFRLSING*
Ga0115008_1001730923300009436MarineMRNTYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDAIPADISEYKIKWRKNATEITIRGQLDKATRWCRTNCYHQDFIIKKYANPDDSHAVYFKNPEEAMLFRLSH*
Ga0115008_1002184093300009436MarineLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPSCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG*
Ga0115103_156189023300009599MarineMKEYLTPKLKENESVDLSLYSPRQRTNIRLYGLDFKDAIPADIFEYKTKWKATATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMIFKLSI*
Ga0115103_170320123300009599MarineLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVYIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI*
Ga0115102_1032098933300009606MarineLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG*
Ga0115102_1053036723300009606MarineLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI*
Ga0115102_1058724323300009606MarineMRNTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNP
Ga0115104_1130004783300009677MarineLTPKLKDGESVDDLSLYSPRERTNIRLYGLAYKDYTPQMISEYRKKWAKNCETVTIRSKLDEATRWCKTNLYHHDFTVLRFANPDDSHSIHFKNPEDAMIFKLSFSG*
Ga0098049_1000090243300010149MarineLTPKLKEGESVDLSLYSPRERTNIRLYGLAFKDYTPQMLWEYKRSWAPNCETVVIRSGLDRAKKWCRTHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSFNG*
Ga0138258_106297123300012413Polar MarineLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKRKWAPHCETVSVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG*
Ga0181377_1000013843300017706MarineMVDSYLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDALPVDIFEYKTKWKSTATKVDIRGNYTKAQKWCKTNCFHQDFEVQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0181377_100169283300017706MarineMRNTYITPKLSEGETVDLSLFSPRERINIRLYGLDFKDATPQDIFEYKNTWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0181377_101141933300017706MarineMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLYEYKRKWAPNCETVTIRGRYTEAQRWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG
Ga0181398_110859713300017725SeawaterDLRSILTVMVDSYLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0181419_117249623300017728SeawaterMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNKWKWQATKVDIRGRLTFAQRWCKTNCFHQDFEIQKYANPDD
Ga0181431_104008723300017735SeawaterLVVMVDSYLTPKLKEGETVDLSLYSPRERTNIRLYGLDFKDFTPQMLHEYKRKWAPNCETVTIRGQYSKAQKWCRTHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSFTG
Ga0181409_106299413300017758SeawaterMVSSYLTPKLKDGESVDDLSLYSPRERTNIRLYGLAYKDYTPQMISEYRKKWAKNCETVTIRSKLDEATRWCKTNLYHHDFTVLRFANPDDSHSIH
Ga0181430_118420713300017772SeawaterMRSTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAV
Ga0181430_118420813300017772SeawaterMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAV
Ga0211690_101413243300020335MarineMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNRWKAESTKVSIRGRLTIAQRWCRTHCFHQNFEIHKYANNDDSHAIYFKNPEEAMLFKLSI
Ga0211576_1025321423300020438MarineMVSSYLTPKLKDGESVDDLSLYSPRERTNIRLYGLAYKDYTPQMISEYRKKWAKNCETVTIRSKLDEATRWCKTNLYHHDFTVLRFANPDDSHSIHFKNPEDAMIFKLSFSG
Ga0206684_123243713300021068SeawaterNVLRNTSQGTDVWCLMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0206678_1024961423300021084SeawaterMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0206677_10000057573300021085SeawaterMVDSYLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0206677_10001026143300021085SeawaterMKEYLTPKLKENESVDLSLYSPRQRTNIRLYGLDFKDAIPADIFEYKTKWKATATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMIFKLSI
Ga0206677_10001485193300021085SeawaterMNTLVVMVDSYLTPKLKEGETVDLSLYSPRERTNIRLYGLDFKDFTPQMLHEYKRKWAPNCETVTIRGQYSKAQKWCRTHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSFTG
Ga0206677_1000243793300021085SeawaterMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG
Ga0206677_1000823413300021085SeawaterMRSTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0206692_143201823300021350SeawaterLRSILTVMVDSYLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0206689_1043334623300021359SeawaterMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANP
Ga0228603_104704123300024183SeawaterLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTETKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0228667_106103523300024226SeawaterLRSILTVMVDSYLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGRYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
(restricted) Ga0233444_1001937723300024264SeawaterMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGRYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG
(restricted) Ga0233444_1031711613300024264SeawaterLMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0228652_105741923300024326SeawaterGTDVWCLMRSTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0228631_105137023300024329SeawaterVMVDSYLTPKLKEGEQVDLSLYSPRQRTNIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0208667_103559323300025070MarineMSTLDDMVDSYLTPKLKEGESVDLSLYSPRERTNIRLYGLAFKDYTPQMLWEYKRSWAPNCETVVIRSGLDRAKKWCRTHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSFNG
Ga0208298_100315543300025084MarineMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDAVPQDIFEYKTKWRKDATEVTIRGRLDKATRWCRTHCFQQDYVIKKYANQDDSHAIYFKNPEEAMLFKLSI
Ga0208434_1002535103300025098MarineMRSPYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNTWKHTATKVDIRGKLSIAQRWCRSNCFQQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0209535_101398623300025120MarineMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNRWKAESTKVSIRGRLTIAQRWCKTNCFHQDFEIQKYANNDDSHAIYFKNPEEAMLFKLSI
Ga0208814_1000077273300025276Deep OceanMNILDVMVDSYLTPKLEEGETVNLSLYNPRQRTNIRLYGLKCKDWTPLDIFDYKHKWLAEEHEELRIDPDRLTQAAKWCKTNLFHQDFTINKFASPDDSHMILFKNSAEAMLFRLSING
Ga0247587_111409223300026504SeawaterMRSTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDVLPVDIFEYKTKWKSTATKVDIRGKYTEAQKWCKTHCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0228647_109828723300026505SeawaterMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRL
Ga0208678_108817413300027233EstuarineLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGRYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG
Ga0208950_102905523300027413MarineMRSTYITPKLSEGETVDLSLYSPRERTNIRLYGLNFKDATPADIFEYKNKWKTNATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0208973_100386563300027506MarineMRSTYITPKLSEGETVDLSLYSPRERTNIRLYGLNFKDATPADIFEYKNRWKAQSTKITIRGKLSLAQKWCRTHCFHQDFEIHKYANNDDSHAVYFKNPEEAMLFKLSI
Ga0208973_104765023300027506MarineLRNISQGTDVWCLMRNTYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDALPVDIFEYKNKWKTNATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0209482_1001666173300027668MarineMRNTYLTPKLREGETVDLSLYSPRERTNIRLYGLDFKNATPADIFEYKTKWSPTATEVSLRGGLDKATRWCRTHCFQQDFKIKKYAKSDDSHIVYFKNAEEAMLFRLSN
Ga0209482_100410723300027668MarineMNTLHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKREWAPHCETVSVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG
Ga0209482_100945083300027668MarineMNTLDVMVDSYLTPKLEEGESLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKRKWAGNCETVTVRGQLDTATKWCRSHCFHQDFTIQKYANPDDSHSIHFKNAEEALLFRLSIG
Ga0209482_109970813300027668MarineMNTLHVMVDSYLTPRLEEGETVDLSLYPPRQRTNIRLYGLAFKDHTPHMIADYKRKWKSSRETVRIRGRLDKSTKWCKTNCFHQDFIIEKFAYPDDTHAIHFKNKEEAMLFRLSIG
Ga0209071_110837713300027686MarineMNTLHVMAASYLTPRLEEGETVDLSLYTPRQRTNIRLYGLKCKDWTPLMIADYKREWAPHCETVSVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG
Ga0209071_118789113300027686MarineMNTSHVMVDSYLTPRLEEGETIDLSLYPPRQRTNIRLYGLAFKDHTPLMISDYKRKWKSKRETVRIKAKLDVATKWCRTNCFHQDFIIEKFAYPDDTHAIHFKNEEEAMLFRLAIG
Ga0209816_106837423300027704MarineMNILDVMVDSYLTPKLEEGERLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKTKWASNCETVTIRGRLDTATKWCRKNCFHQDFTIQKYANPDDSHSIHFKNPEEALLFKLSIG
Ga0209816_124545513300027704MarineMNTSHVMVDSYLTPRLEEGETIDLSLYPPRQRTNIRLYGLAFKDHTPLMISDYKRKWKSKRETVRIKAKLDVATKWCRTNCFHQDFIIEKFAYPDDTHAIHFKNEEEAMLFR
Ga0209090_1000950093300027813MarineNALMNTLHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKREWAPHCETVSVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLSIG
Ga0209090_1002638573300027813MarineLDVMVDSYLTPKLEEGESLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKRKWAGNCETVTVRGQLDTATKWCRSHCFHQDFTIQKYANPDDSHSIHFKNAEEALLFRLSIG
Ga0209092_100000331093300027833MarineMRNTYITPKLREGETVDLSLYSPRERTNIRLYGLDFKDAIPADISEYKIKWRKNATEITIRGQLDKATRWCRTNCYHQDFIIKKYANPDDSHAVYFKNPEEAMLFRLSH
Ga0209092_1026487313300027833MarineMNILVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPSCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFRLSITG
Ga0256411_101559243300028134SeawaterMRSTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTNATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAVYFKNPEEAMLFKLSI
Ga0256412_112406923300028137SeawaterMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKNAEEAMLFR
Ga0228627_100648173300028414SeawaterMNTLVDMVDSYLTPKLREGESVDLSLYSPRERTNIRLYGLDFKDYTPQMLFEYKRKWAPNCETVTIRGKYTEAQKWCRKHCFHQDFEIQKYANPDDSHSVHFKN
Ga0228615_107622913300028418SeawaterQGTDVWCLMRSTYITPKLREGETVDLSLYSPRQRINIRLYGLDFKDALPVDIFEYKNKWKTTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0308024_101260713300031140MarineMRNTYLTPKLREGETVDLSLYSPRERTNIRLYGLDFKNATPADIFEYKTKWSPTATEVSLRGGLDKATRWCRTHCFQQDFKIKKYAKSDDS
Ga0308025_102527143300031143MarineMNILDVMVDSYLTPKLEEGETVNLSLYNPRQRTNIRLYGLKCKDWTPLDIFDYKHKWLAEEHEELRIDPDRLTQAAKWCKTNLFHQDFTINKFASPDDSHMILFKNSA
Ga0308007_1007593613300031599MarineMNILDVMVDSYLTPKLEEGERLDLSLYPPRERTNIRLYGVAFKDYTPQMIFEYKTKWASNCETVTIRGRLDTATKWCRKNCFHQDFTIQKYANPDDSHSIHFKNPEEALLF
Ga0307993_100934013300031602MarineMRNTYLTPKLREGETVDLSLYSPRERTNIRLYGLDFKNATPADIFEYKTKWSPTATEVSLRGGLDKATRWCRTHCFQQDFKIKKYAKSDDSHIV
Ga0307999_103975513300031608MarineMNTLHVMAASYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKREWAPHCETVSVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAI
Ga0307994_122131523300031660MarineYLTPKLREGETVDLSLYSPRERTNIRLYGLDFKNATPADIFEYKTKWSPTATEVSLRGGLDKATRWCRTHCFQQDFKIKKYAKSDDSHIVYFKNAEEAMLFRLSN
Ga0302122_1006155323300031675MarineMNTLHVMVDSYLTPRLEEGETVDLSLYPPRQRTNIRLYGLKCKDWTPLMIADYKRKWAPHCETVRVRGRLDKATKWCKTNCFHQDFTIEKFANPDDTHAIHFKNQEEAMLFRLAIG
Ga0308011_1013870723300031688MarineLMNTSHVMVDSYLTPRLEEGETIDLSLYPPRQRTNIRLYGLAFKDHTPLMISDYKRKWKSKRETVRIKAKLDVATKWCRTNCFHQDFIIEKFAYPDDTHAIHFKNEEEAMLFRLAIG
Ga0315322_10004026133300031766SeawaterMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDATPQDIFEYKNKWKWQATKVDIRGRLTFAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI
Ga0315331_1074208923300031774SeawaterMRSSYITPKLREGEIVDLSLYSPRERTNIRLYGLDFKDALPADIFEYKNKWKHTATKVDIRGKLSIAQRWCKTNCFHQDFEIQKYANPDDSHAIYFKNPEEAMLFKLSI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.