| Basic Information | |
|---|---|
| Family ID | F090839 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 47 residues |
| Representative Sequence | TGGRNEAEIRSEVALPDFGLIVTMESAVGAMPVGPAVGTIHIVP |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.519 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.185 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.222 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.44% Coil/Unstructured: 80.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF13365 | Trypsin_2 | 24.07 |
| PF13414 | TPR_11 | 6.48 |
| PF05193 | Peptidase_M16_C | 3.70 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF04253 | TFR_dimer | 0.93 |
| PF02557 | VanY | 0.93 |
| PF11821 | ActD | 0.93 |
| PF00089 | Trypsin | 0.93 |
| PF02780 | Transketolase_C | 0.93 |
| PF01791 | DeoC | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.44 % |
| Unclassified | root | N/A | 30.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_14287270 | Not Available | 510 | Open in IMG/M |
| 3300001990|JGI24737J22298_10049157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
| 3300002155|JGI24033J26618_1051880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300004157|Ga0062590_102851210 | Not Available | 517 | Open in IMG/M |
| 3300005293|Ga0065715_10937649 | Not Available | 563 | Open in IMG/M |
| 3300005294|Ga0065705_10286171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300005295|Ga0065707_10254534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300005295|Ga0065707_10832974 | Not Available | 588 | Open in IMG/M |
| 3300005334|Ga0068869_100668279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300005340|Ga0070689_100511974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300005341|Ga0070691_10084182 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005345|Ga0070692_10109161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1528 | Open in IMG/M |
| 3300005345|Ga0070692_11208083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005356|Ga0070674_101602108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005365|Ga0070688_100871660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300005564|Ga0070664_101537942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300005564|Ga0070664_101675013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300005578|Ga0068854_101130717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300005841|Ga0068863_101830871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005841|Ga0068863_102161776 | Not Available | 566 | Open in IMG/M |
| 3300006169|Ga0082029_1461243 | Not Available | 534 | Open in IMG/M |
| 3300006804|Ga0079221_11282735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300006845|Ga0075421_101989712 | Not Available | 619 | Open in IMG/M |
| 3300006847|Ga0075431_100565490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300006853|Ga0075420_100049913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3724 | Open in IMG/M |
| 3300006881|Ga0068865_100952348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300006904|Ga0075424_101893838 | Not Available | 630 | Open in IMG/M |
| 3300006904|Ga0075424_101989887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 613 | Open in IMG/M |
| 3300006954|Ga0079219_12359730 | Not Available | 515 | Open in IMG/M |
| 3300006969|Ga0075419_10620323 | Not Available | 761 | Open in IMG/M |
| 3300009011|Ga0105251_10208391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300009093|Ga0105240_11794389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300009093|Ga0105240_12062489 | Not Available | 592 | Open in IMG/M |
| 3300009147|Ga0114129_11110530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300009147|Ga0114129_11347433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300009147|Ga0114129_12081920 | Not Available | 685 | Open in IMG/M |
| 3300009148|Ga0105243_12016723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300009148|Ga0105243_13086407 | Not Available | 504 | Open in IMG/M |
| 3300009177|Ga0105248_10020625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 7304 | Open in IMG/M |
| 3300009553|Ga0105249_12791552 | Not Available | 560 | Open in IMG/M |
| 3300010037|Ga0126304_10409876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300010037|Ga0126304_10745970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300010041|Ga0126312_10662718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300010045|Ga0126311_10004472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 7338 | Open in IMG/M |
| 3300010046|Ga0126384_10423641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300010046|Ga0126384_11584086 | Not Available | 616 | Open in IMG/M |
| 3300010166|Ga0126306_10542959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300010362|Ga0126377_13225054 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Helarchaeota → Candidatus Helarchaeota archaeon | 527 | Open in IMG/M |
| 3300010371|Ga0134125_11871498 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010373|Ga0134128_12941271 | Not Available | 524 | Open in IMG/M |
| 3300010396|Ga0134126_10317521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1824 | Open in IMG/M |
| 3300010397|Ga0134124_10245351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300010399|Ga0134127_11587614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300011003|Ga0138514_100132541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300011119|Ga0105246_10685438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300011270|Ga0137391_10029239 | All Organisms → cellular organisms → Bacteria | 4612 | Open in IMG/M |
| 3300011332|Ga0126317_11104579 | Not Available | 514 | Open in IMG/M |
| 3300012469|Ga0150984_116081454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012899|Ga0157299_10120005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300012917|Ga0137395_10351200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300012951|Ga0164300_10585307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300013297|Ga0157378_13099179 | Not Available | 516 | Open in IMG/M |
| 3300013308|Ga0157375_11523336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300013308|Ga0157375_12685631 | Not Available | 595 | Open in IMG/M |
| 3300014325|Ga0163163_11631048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300014325|Ga0163163_12754787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 548 | Open in IMG/M |
| 3300014326|Ga0157380_12645808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300014745|Ga0157377_10604984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300014968|Ga0157379_11529097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300015371|Ga0132258_10544552 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
| 3300015374|Ga0132255_101795052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300018469|Ga0190270_12068380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300025900|Ga0207710_10052751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
| 3300025904|Ga0207647_10593083 | Not Available | 612 | Open in IMG/M |
| 3300025908|Ga0207643_10330202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300025913|Ga0207695_11520822 | Not Available | 550 | Open in IMG/M |
| 3300025923|Ga0207681_11349349 | Not Available | 599 | Open in IMG/M |
| 3300025925|Ga0207650_11446785 | Not Available | 584 | Open in IMG/M |
| 3300025926|Ga0207659_10343699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300025930|Ga0207701_10652035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300025934|Ga0207686_11507960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300025936|Ga0207670_10081520 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300025936|Ga0207670_10558685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300025936|Ga0207670_11156739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300025960|Ga0207651_11966625 | Not Available | 526 | Open in IMG/M |
| 3300025981|Ga0207640_10167789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1632 | Open in IMG/M |
| 3300025981|Ga0207640_11524455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 601 | Open in IMG/M |
| 3300026035|Ga0207703_10503484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300026035|Ga0207703_11215243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300026035|Ga0207703_11265714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300026041|Ga0207639_11664274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300026088|Ga0207641_11826493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300026095|Ga0207676_10695113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300026095|Ga0207676_12302100 | Not Available | 536 | Open in IMG/M |
| 3300026116|Ga0207674_11871157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300026142|Ga0207698_11576522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300027787|Ga0209074_10408478 | Not Available | 571 | Open in IMG/M |
| 3300028380|Ga0268265_12223652 | Not Available | 555 | Open in IMG/M |
| 3300028381|Ga0268264_12171569 | Not Available | 563 | Open in IMG/M |
| 3300031548|Ga0307408_100095281 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300031562|Ga0310886_10951807 | Not Available | 548 | Open in IMG/M |
| 3300031740|Ga0307468_102572798 | Not Available | 500 | Open in IMG/M |
| 3300031911|Ga0307412_11058326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300032017|Ga0310899_10494498 | Not Available | 600 | Open in IMG/M |
| 3300033179|Ga0307507_10421219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300033412|Ga0310810_11045069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.85% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_142872701 | 3300000550 | Soil | NTYSKLGQVVNTPGRNEAEIRSEVPLPDFGLLVTMEAAEGASPLGPLVGTIHIVP* |
| JGI24737J22298_100491571 | 3300001990 | Corn Rhizosphere | NVKGRNEAEIKSEVALSDFGLVITMEGAEGAIPVGPAVGTIHIIP* |
| JGI24033J26618_10518802 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | EIKSETTLXDFGLVVTMEGADADMPAGPAVGTITIVP* |
| Ga0062590_1028512101 | 3300004157 | Soil | NTGGRNEAEIKSEVALPDFGLIVTMEGAEGETPIGPAVGTIHIVP* |
| Ga0065715_109376492 | 3300005293 | Miscanthus Rhizosphere | APGRNEAEIKSEVSMPDFGLVVTMESAEGEMPVGPAVGTIHIVP* |
| Ga0065705_102861712 | 3300005294 | Switchgrass Rhizosphere | GGRNEAEIRSEVPLPDFGLIVTMESAVGAMPAGPAIGTIHIVP* |
| Ga0065707_102545342 | 3300005295 | Switchgrass Rhizosphere | NVPGRNEAEIKSETTLPDFGLVVTMEGSDVATPIGPAVGTITIVP* |
| Ga0065707_108329742 | 3300005295 | Switchgrass Rhizosphere | KLGEIVNTGGRNEAEIKSEVALPDFGLIVTMESAVGAMPVGPAVGTIHIVP* |
| Ga0068869_1006682791 | 3300005334 | Miscanthus Rhizosphere | GRNEAEIKSETNFPDFGLLITMESAIGESPLGPTVGTIHIVP* |
| Ga0070689_1005119741 | 3300005340 | Switchgrass Rhizosphere | VSPDNKFSKLGEVVNTAGRNEAEIKSETALPDFGLLITAESTIGESPAGPTVGTIHIVP* |
| Ga0070691_100841823 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | QQFVKLGQVVNAPGRNEAEIKSETTLPDFGLLVTMENATGIGAAPVGPRIGLIHIVP* |
| Ga0070692_101091611 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VISTGGKNEAEIKTETALQDFGLVVTMESAIGVKPVGPAVAHIHIVP* |
| Ga0070692_112080831 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPDNKYIRLGQVVNTGGRNEAEIRSEVPLPDFGLIVTMESAVGEMPVGPAIGTIHIVP* |
| Ga0070674_1016021081 | 3300005356 | Miscanthus Rhizosphere | KLGQVVNTPGRNEAEIKSETTLPDFGLLVTMENATAIGAMPVGPRIGLIHIVP* |
| Ga0070688_1008716601 | 3300005365 | Switchgrass Rhizosphere | GRNEAEIKSETSFPDFGLLITMESAIGESPVGPTVGVIHLVP* |
| Ga0070664_1015379422 | 3300005564 | Corn Rhizosphere | QVVNAPGRNEAEIKSETTLPDFGLVVTMEGADAEMPAGPTVGTIHIVP* |
| Ga0070664_1016750131 | 3300005564 | Corn Rhizosphere | GKNEAEVNSTVALSDFGLIVTMESVVGAMPVGPAIGTIHIVP* |
| Ga0068854_1011307172 | 3300005578 | Corn Rhizosphere | TGGRNEAEIKSEVPLPDFGLVVTMESAVGEMPMGPAIGTIHIVP* |
| Ga0068864_1009908941 | 3300005618 | Switchgrass Rhizosphere | VGADGTYQKLGEIVNTGGKNEAEFKTETALADFGLLLTMESAIGTAPAGPAVATIHIVP* |
| Ga0068863_1018308711 | 3300005841 | Switchgrass Rhizosphere | YIRLGQIVNTGGRNEAEIRSEVPLPDFGLIVTLESAVGEMPAGPAIGTIHIVP* |
| Ga0068863_1021617761 | 3300005841 | Switchgrass Rhizosphere | VNTKDRNEAEIKSEVALADFGLVITMESAVGAMPVGPAVGTIMIVP* |
| Ga0082029_14612432 | 3300006169 | Termite Nest | AMSADGQFQKLGQIVNAKGRNEAEIKSETTLTDFGLVVTMEAADAPMPAGPAVAHIHIVP |
| Ga0079221_112827352 | 3300006804 | Agricultural Soil | GGKNEAEVNSVVSYPDFGLIVTLENAIGAMPVGPAIGTIHIVP* |
| Ga0075421_1019897122 | 3300006845 | Populus Rhizosphere | PDNKFTKIGEIVNTGGRNEAELRSEVALPDFGLIVTMESAVGDMPVGPAIGNIHIVP* |
| Ga0075431_1005654901 | 3300006847 | Populus Rhizosphere | VNTGGKNEAEIMSQTALPDFGLVVTMESAIGPKPVGPAVAHIHIIP* |
| Ga0075420_1000499131 | 3300006853 | Populus Rhizosphere | GKNEAEIKSETALPDFGLVVTMESAIGPKPVGPAVAHIHIIP* |
| Ga0068865_1009523482 | 3300006881 | Miscanthus Rhizosphere | NQFTKLGQIVNAPGRNEAEIKSEVALPDFGLVVTMESADADMPAGPTVGTIHIVP* |
| Ga0075424_1018938382 | 3300006904 | Populus Rhizosphere | VNTAGRNEAEIKSETSLPDFGLLVTMENADSETPVGPIVGNIHIVP* |
| Ga0075424_1019898872 | 3300006904 | Populus Rhizosphere | SPDNKFTKLGQIVNTKDRNEAEIKSEVALADFGLVITMESAVGAIPVGPAVGTIMIVP* |
| Ga0079219_123597301 | 3300006954 | Agricultural Soil | GRNEAEIQSETTLPDFGLVVTMEGADGESPVGPAVGTIHIVP* |
| Ga0075419_106203231 | 3300006969 | Populus Rhizosphere | KLGQVVNAPGRNEAEIKSETSLKDFGLLITMESADGEAPVGPVVGTIHIVP* |
| Ga0105251_102083912 | 3300009011 | Switchgrass Rhizosphere | LGQVINSKDRNEAEIRSEVALADFGLVITMENAVGAAPVGPAVGTITIVP* |
| Ga0105240_117943892 | 3300009093 | Corn Rhizosphere | SEVPLPDFGLVVTMESTVGDMPVGPAIGTIHIVP* |
| Ga0105240_120624891 | 3300009093 | Corn Rhizosphere | NEAEIKSEVPLPDFGLVVTMESAVGEMPVGPAIGTIHIVP* |
| Ga0114129_111105302 | 3300009147 | Populus Rhizosphere | GQVVNAPGRNEAEIKSEVALPDFGLVVTMESADADMPAGPTVGTIHIVP* |
| Ga0114129_113474332 | 3300009147 | Populus Rhizosphere | DMKFVKLGEVVNTPGRNEAEIKSETTLPDFGLIVTMESAVGETPVGPSVATIHIVP* |
| Ga0114129_120819201 | 3300009147 | Populus Rhizosphere | IVNAPGRNEAEIKAETTLPDFGLLVTMEDAAKLGEMPMGPRIGHIHIIP* |
| Ga0105243_120167231 | 3300009148 | Miscanthus Rhizosphere | AEIKSETTLPDFGLVVTMEAPDVVTPAGPSVATIHIIP* |
| Ga0105243_130864071 | 3300009148 | Miscanthus Rhizosphere | NTGGRNEAEIRSEVPLPDFGLVVTMESAVGEMPVGPAIGTIHIVP* |
| Ga0105248_100206251 | 3300009177 | Switchgrass Rhizosphere | LGQVVNAPGRNEAEIKSEVALPDFGLVVTMESADADMPGGPTVGTIHIVP* |
| Ga0105249_127915522 | 3300009553 | Switchgrass Rhizosphere | EILNTGNRNEAEIKSEVALPDFGLIVTMEGAEGETPIGPAVGTIHIVP* |
| Ga0126304_104098762 | 3300010037 | Serpentine Soil | EAEIQSETTLQDFGLVVTMEGADAEMPAGPSVATIHIIP* |
| Ga0126304_107459701 | 3300010037 | Serpentine Soil | NEAEIKSETTLQDFGLVVTMESADGEMPVGPSVGTIHIVP* |
| Ga0126312_106627182 | 3300010041 | Serpentine Soil | KLGQVVNTKGRNEAEIKSETTLADFGLLITMEGAEVGSPAGPAVATIHIVP* |
| Ga0126311_100044726 | 3300010045 | Serpentine Soil | VVNTAGRNEAEIRSEVNLPDFGLVVTMENAEGAMPVGPTVGTIHIVP* |
| Ga0126384_104236412 | 3300010046 | Tropical Forest Soil | GGRNEAEIRSEVPLPDFGLIVTMESAVGAMPVGPAIGTIHIVP* |
| Ga0126384_115840861 | 3300010046 | Tropical Forest Soil | FVKLGQVVNTAGRNEAEIKSETEMRDFGLLVTMEGPSVITPVGPAVGVIRIVP* |
| Ga0126306_105429592 | 3300010166 | Serpentine Soil | GRNEAEIRSETTLTDFGLVVTMESADGEMPVGPAVGNIQIVP* |
| Ga0126377_132250541 | 3300010362 | Tropical Forest Soil | EIKSELALADFGLVITMENAVGAIPIGPAVGTITIVP* |
| Ga0134125_118714982 | 3300010371 | Terrestrial Soil | QSEVNWPDFGLLITMEAASATGEGPVGPAVGNIRIVP* |
| Ga0134128_129412711 | 3300010373 | Terrestrial Soil | IVNTKDRNEAEIKSEVALADFGLVITMESAVGAIPVGPAVGTIMIVP* |
| Ga0134126_103175211 | 3300010396 | Terrestrial Soil | NEAEVNAQVSYPDFGLIVTLENAVGAMPVGPTVGTIHIVP* |
| Ga0134124_102453511 | 3300010397 | Terrestrial Soil | NTFTKLGQIVNTKDRNEAEIKSEVALADFGLVITMESAVGAMPVGPAVGTITIVP* |
| Ga0134127_115876141 | 3300010399 | Terrestrial Soil | NEAEIKSEVALADFGLVITMENAVGAIPVGPAVGTITIIP* |
| Ga0138514_1001325412 | 3300011003 | Soil | VWAVGADGTYQKLGQIANVKGRNEAEIKSETTLPDFGLLITMEGAEVPSPVGPAVGTIHIVP* |
| Ga0105246_106854381 | 3300011119 | Miscanthus Rhizosphere | KNEAEIKTETALQDFGLVVTMESAIGVKPVGPAVAHIHIVP* |
| Ga0137391_100292391 | 3300011270 | Vadose Zone Soil | NTPGRNEAEIKSETNLKDFGLLVTMEDASLKTWVSPAGPPVGIIHIVP* |
| Ga0126317_111045791 | 3300011332 | Soil | NTGGRNEAELRSEVALPDFGLIVTMESAVGAMPVGPAIGTIHIVP* |
| Ga0150984_1160814541 | 3300012469 | Avena Fatua Rhizosphere | YIRLGQIVNTGGRNEAEIRSEVPLPDFGLIVTMESAVGEMPAGPAIGTIHIVP* |
| Ga0157299_101200051 | 3300012899 | Soil | PGRNEAEIKSEVSMPDFGLVVTMESAEGEMPVGPAVGTIHIVP* |
| Ga0137395_103512002 | 3300012917 | Vadose Zone Soil | PGRNEAEIKSETNLKDFGLLVTMEDASLKTWVSPAGPPVGIIHIVP* |
| Ga0164300_105853072 | 3300012951 | Soil | NAPGRNEAEIKSEVALPDFGLVVTMESADADMPAGPTIGTIHIVP* |
| Ga0157378_130991792 | 3300013297 | Miscanthus Rhizosphere | VSPDMKFTKLGEIVNTGGRNEAEIKSEVAMPDFGLIVTMEGAEGETPIGPAVGTIHIVP* |
| Ga0157375_115233362 | 3300013308 | Miscanthus Rhizosphere | TFTKLGQIVNTKDRNEAEIKSEVALADFGLVITMESAIGAMPVGPAVGTITIVP* |
| Ga0157375_126856311 | 3300013308 | Miscanthus Rhizosphere | EAEIKSETSLPDFGLLVTMENADSESPLGPTVGTIHIVP* |
| Ga0163163_116310481 | 3300014325 | Switchgrass Rhizosphere | SEVALADFGLVITMESAVGAIPVGPAVGTIMIVP* |
| Ga0163163_127547871 | 3300014325 | Switchgrass Rhizosphere | VSPDNTFTKLGQIVNTKDRNEAEIKSEVALADFGLVITMESAVGAIPVGPAVGTIMIVP* |
| Ga0157380_126458081 | 3300014326 | Switchgrass Rhizosphere | FQKLGQVVNVKGRNEAEIKSETTLTDFGLVVTMESAEAPMPAGPAVAHIHIVP* |
| Ga0157377_106049841 | 3300014745 | Miscanthus Rhizosphere | VSPVNKYTKIGEVINTGGRNEAEIRSEVALPDFGLIVTMESAVGEIPVGPAVGTIHIVP* |
| Ga0157379_115290972 | 3300014968 | Switchgrass Rhizosphere | GQVVNVPGRNEAEIKSETTLPDFGLVVTMEGADGESPVGPAVGTIHIVP* |
| Ga0132258_105445521 | 3300015371 | Arabidopsis Rhizosphere | RNEAEIKSETALQDFGLLITAESTIGESPTGPTVGTIQIVP* |
| Ga0132255_1017950522 | 3300015374 | Arabidopsis Rhizosphere | VVNTKGRNEAEIRSETTLPDFGLLVTMENVVGAAPIGPAVATIHIVP* |
| Ga0190270_120683801 | 3300018469 | Soil | NEAEIKSETTLPDFGLVVTMEGADGELPVGPAVGTITIIPAG |
| Ga0207710_100527512 | 3300025900 | Switchgrass Rhizosphere | VNAPGRNEAEIKSEVALPDFGLVVTMESADADMPGGPTVGTIHIVP |
| Ga0207647_105930831 | 3300025904 | Corn Rhizosphere | EAEIQSETTLPDFGLLVTMEGSMVESPIGPTVGTIHIVP |
| Ga0207643_103302022 | 3300025908 | Miscanthus Rhizosphere | EAEIRSEVPLPDFGLIVTMESAVGELPVGPAIGTIHIVP |
| Ga0207695_115208222 | 3300025913 | Corn Rhizosphere | EAEIKSEVALPDFGLIVTMEGAEGETPIGPAVGTIHIVP |
| Ga0207681_113493491 | 3300025923 | Switchgrass Rhizosphere | ADNKVTKRGQIVNAPGRNEAEIKSETTLPDFGLVVTMEGADADMPAGPAIGTITIVP |
| Ga0207650_114467851 | 3300025925 | Switchgrass Rhizosphere | GQVVNTPGRNEAEIKSEVTLPDFGLVVTMEGADAEMPAGPAVAHIHIIQ |
| Ga0207659_103436992 | 3300025926 | Miscanthus Rhizosphere | PDNQFTKIGEVINTGGRNEAEIRSEVALPDFGLIVTMESAVGEMPVGPAIGTIHIVP |
| Ga0207701_106520352 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | EIKSETALPDFGLLITAESTIGESPAGPTVGTIHIVP |
| Ga0207686_115079601 | 3300025934 | Miscanthus Rhizosphere | KFIRLGQVVNTGGRNEAEIRSEVPLPDFGLIVTMESAVGEMPVGPAIGTIHIVP |
| Ga0207670_100815201 | 3300025936 | Switchgrass Rhizosphere | DIVNTGGKNEAEVNSTVALPDFGLIVTMESVIGAMPVGPAIGTIHIVP |
| Ga0207670_105586852 | 3300025936 | Switchgrass Rhizosphere | GQVVNVKGRNEAEIKSETTLTDFGLVVTMESAEAPMPAGPAVAHIHIVP |
| Ga0207670_111567391 | 3300025936 | Switchgrass Rhizosphere | GQVVNTGGRNEAEIRSEVPLPDFGLIVTMESAVGEMPVGPAIGTIHIVP |
| Ga0207651_119666251 | 3300025960 | Switchgrass Rhizosphere | TGGRNEAEIRSEVALPDFGLIVTMESAVGAMPVGPAVGTIHIVP |
| Ga0207640_101677892 | 3300025981 | Corn Rhizosphere | NEAEIKSETALPDFGLLITAESTIGESPAGPTVGTIHIVP |
| Ga0207640_115244551 | 3300025981 | Corn Rhizosphere | IKSEVALPDFGLVVTMESADADMPAGPTVGTITIVP |
| Ga0207703_105034842 | 3300026035 | Switchgrass Rhizosphere | AGRNEAEIKSETALPDFGLLITAESTIGESPAGPTVGTIHIAP |
| Ga0207703_112152431 | 3300026035 | Switchgrass Rhizosphere | LGEIVNTGGKNEAEVNSTVALSDFGLIVTMESVVGAMPVGPAIGTIHIVP |
| Ga0207703_112657142 | 3300026035 | Switchgrass Rhizosphere | GRNEAEIRSEVPLPDFGLIVTMESAVGEMPVGPAIGTIHIVP |
| Ga0207639_116642741 | 3300026041 | Corn Rhizosphere | KGRNEAEIKSEVALSDFGLVITMEGAEGAIPVGPAIGTIHIIP |
| Ga0207641_118264931 | 3300026088 | Switchgrass Rhizosphere | TFTKLGQIVNTKDRNEAEIKSEVALADFGLVITMESAVGAMPVGPAVGTIMIVP |
| Ga0207676_106951131 | 3300026095 | Switchgrass Rhizosphere | PDNQFTKIGEVINTGGRNEAEIRSEVALPDFGLIVTMESAVGAMPVGPAVGTIHIVP |
| Ga0207676_123021002 | 3300026095 | Switchgrass Rhizosphere | GQITNTGGRNEAEIKSEVPLPDFGLVVTMESTVGEMPMGPAIGTIHIVP |
| Ga0207674_116765101 | 3300026116 | Corn Rhizosphere | GHNEAEIKTETTLPDFGLLITMENAIGASPVGPGVAHIHIVP |
| Ga0207674_118711571 | 3300026116 | Corn Rhizosphere | RSEVPLPDFGLIVTMESAVGETPIGPSIGTIHIVP |
| Ga0207698_115765221 | 3300026142 | Corn Rhizosphere | GRNEAEIKSETTLTDFGLVVTMESAEAPMPAGPAVAHIHIVP |
| Ga0209074_104084782 | 3300027787 | Agricultural Soil | MKFTKLGEILNTGGRNEAEIKSEVAMPDFGLIVTMEGAEGETPIGPAVGTIHIVP |
| Ga0268265_122236522 | 3300028380 | Switchgrass Rhizosphere | EAEIKSETSFPDFGLLITMESAIGESPVGPTVGVIHLVP |
| Ga0268264_121715691 | 3300028381 | Switchgrass Rhizosphere | NTKDRNEAEIKSEVALADFGLIITMESAVGAIPVGPAVGTIMIVP |
| Ga0307408_1000952813 | 3300031548 | Rhizosphere | KNEAEIKTETALQDFGLIVTMESAIGVKPVGPAVAHIHIVP |
| Ga0310886_109518071 | 3300031562 | Soil | NAPGRNEAEIKSEVALPDFGLVVTMESADADMPAGPTVGTIHIVP |
| Ga0307468_1025727981 | 3300031740 | Hardwood Forest Soil | TAGRNEAEIKSEVPLPDFGLIVTMESAIGETPVGPSIGTIHIVP |
| Ga0307412_110583262 | 3300031911 | Rhizosphere | VVNTKGRNEAEIKSEVNLPDFGLLVTMEDADVPSPAGPGVAHIHIVP |
| Ga0310899_104944981 | 3300032017 | Soil | NEAEIKSETSLQDFGLVITMESADGAANPLGPTIGTIHIVP |
| Ga0307507_104212192 | 3300033179 | Ectomycorrhiza | AEIKSETTLPDFGLVVTMEGADADMPAGPTVGTIHIIP |
| Ga0310810_110450692 | 3300033412 | Soil | EFRSETTFPDFGLLVTMESAVGTAPVGPAVATIHIIP |
| ⦗Top⦘ |