| Basic Information | |
|---|---|
| Family ID | F090838 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LSDLQRREFHEALLEADSFEDLPGKWQAAILAAEQNRPKLRVVTGD |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.70 % |
| % of genes near scaffold ends (potentially truncated) | 46.30 % |
| % of genes from short scaffolds (< 2000 bps) | 81.48 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.778 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (41.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.481 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF12680 | SnoaL_2 | 13.89 |
| PF03861 | ANTAR | 2.78 |
| PF10057 | MpsC | 1.85 |
| PF07676 | PD40 | 1.85 |
| PF02322 | Cyt_bd_oxida_II | 0.93 |
| PF13193 | AMP-binding_C | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF12850 | Metallophos_2 | 0.93 |
| PF13683 | rve_3 | 0.93 |
| PF01654 | Cyt_bd_oxida_I | 0.93 |
| PF13229 | Beta_helix | 0.93 |
| PF03631 | Virul_fac_BrkB | 0.93 |
| PF01497 | Peripla_BP_2 | 0.93 |
| PF05694 | SBP56 | 0.93 |
| PF09335 | SNARE_assoc | 0.93 |
| PF00011 | HSP20 | 0.93 |
| PF01483 | P_proprotein | 0.93 |
| PF00578 | AhpC-TSA | 0.93 |
| PF00903 | Glyoxalase | 0.93 |
| PF00353 | HemolysinCabind | 0.93 |
| PF13489 | Methyltransf_23 | 0.93 |
| PF00122 | E1-E2_ATPase | 0.93 |
| PF14690 | zf-ISL3 | 0.93 |
| PF00582 | Usp | 0.93 |
| PF00501 | AMP-binding | 0.93 |
| PF02426 | MIase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 2.78 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4935 | Regulatory P domain of the subtilisin-like proprotein convertases and other proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG4829 | Muconolactone delta-isomerase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.93 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.93 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.93 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.93 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.78 % |
| All Organisms | root | All Organisms | 47.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2323927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1110 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13677217 | Not Available | 545 | Open in IMG/M |
| 3300000858|JGI10213J12805_10022502 | Not Available | 1863 | Open in IMG/M |
| 3300003373|JGI25407J50210_10002711 | All Organisms → cellular organisms → Bacteria | 4212 | Open in IMG/M |
| 3300003373|JGI25407J50210_10007593 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
| 3300003373|JGI25407J50210_10050475 | Not Available | 1055 | Open in IMG/M |
| 3300004157|Ga0062590_102256938 | Not Available | 571 | Open in IMG/M |
| 3300004463|Ga0063356_101016773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1185 | Open in IMG/M |
| 3300004463|Ga0063356_102206503 | Not Available | 838 | Open in IMG/M |
| 3300004479|Ga0062595_101584272 | Not Available | 609 | Open in IMG/M |
| 3300005341|Ga0070691_10869031 | Not Available | 554 | Open in IMG/M |
| 3300005457|Ga0070662_101460005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 590 | Open in IMG/M |
| 3300005546|Ga0070696_100577420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 904 | Open in IMG/M |
| 3300005562|Ga0058697_10286464 | Not Available | 781 | Open in IMG/M |
| 3300005981|Ga0081538_10001921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20817 | Open in IMG/M |
| 3300005981|Ga0081538_10009863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7898 | Open in IMG/M |
| 3300005981|Ga0081538_10062774 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300005981|Ga0081538_10106710 | Not Available | 1389 | Open in IMG/M |
| 3300005981|Ga0081538_10115274 | Not Available | 1307 | Open in IMG/M |
| 3300005981|Ga0081538_10228219 | Not Available | 730 | Open in IMG/M |
| 3300006058|Ga0075432_10393238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300006169|Ga0082029_1631983 | Not Available | 633 | Open in IMG/M |
| 3300006844|Ga0075428_100075007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3695 | Open in IMG/M |
| 3300006853|Ga0075420_101390532 | Not Available | 602 | Open in IMG/M |
| 3300006876|Ga0079217_11241492 | Not Available | 570 | Open in IMG/M |
| 3300006880|Ga0075429_100176881 | Not Available | 1870 | Open in IMG/M |
| 3300009147|Ga0114129_10842734 | Not Available | 1166 | Open in IMG/M |
| 3300009156|Ga0111538_12743862 | Not Available | 617 | Open in IMG/M |
| 3300009789|Ga0126307_10005552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8841 | Open in IMG/M |
| 3300009789|Ga0126307_11709811 | Not Available | 511 | Open in IMG/M |
| 3300009840|Ga0126313_10019053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4531 | Open in IMG/M |
| 3300009840|Ga0126313_10035567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3445 | Open in IMG/M |
| 3300009840|Ga0126313_10044696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 3100 | Open in IMG/M |
| 3300009840|Ga0126313_10120018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1955 | Open in IMG/M |
| 3300009840|Ga0126313_10168926 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300009840|Ga0126313_10325993 | Not Available | 1205 | Open in IMG/M |
| 3300009840|Ga0126313_10362813 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300009840|Ga0126313_10420378 | Not Available | 1062 | Open in IMG/M |
| 3300009840|Ga0126313_11180072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas | 630 | Open in IMG/M |
| 3300009840|Ga0126313_11186686 | Not Available | 629 | Open in IMG/M |
| 3300009840|Ga0126313_11243674 | Not Available | 614 | Open in IMG/M |
| 3300010036|Ga0126305_10252943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300010036|Ga0126305_10447346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300010036|Ga0126305_10943014 | Not Available | 590 | Open in IMG/M |
| 3300010037|Ga0126304_10081438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 2020 | Open in IMG/M |
| 3300010037|Ga0126304_10171494 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300010037|Ga0126304_10607268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
| 3300010037|Ga0126304_10756167 | Not Available | 658 | Open in IMG/M |
| 3300010038|Ga0126315_10048284 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300010038|Ga0126315_10318476 | Not Available | 963 | Open in IMG/M |
| 3300010038|Ga0126315_10337027 | Not Available | 937 | Open in IMG/M |
| 3300010038|Ga0126315_10656497 | Not Available | 681 | Open in IMG/M |
| 3300010038|Ga0126315_10898511 | Not Available | 588 | Open in IMG/M |
| 3300010038|Ga0126315_11171744 | Not Available | 521 | Open in IMG/M |
| 3300010040|Ga0126308_10076340 | Not Available | 2007 | Open in IMG/M |
| 3300010040|Ga0126308_10262403 | Not Available | 1126 | Open in IMG/M |
| 3300010040|Ga0126308_10762104 | Not Available | 668 | Open in IMG/M |
| 3300010041|Ga0126312_10041583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 3071 | Open in IMG/M |
| 3300010041|Ga0126312_10107218 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300010041|Ga0126312_10132870 | Not Available | 1720 | Open in IMG/M |
| 3300010041|Ga0126312_10387399 | Not Available | 993 | Open in IMG/M |
| 3300010041|Ga0126312_10520445 | Not Available | 852 | Open in IMG/M |
| 3300010042|Ga0126314_10056409 | Not Available | 2568 | Open in IMG/M |
| 3300010042|Ga0126314_10232273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1306 | Open in IMG/M |
| 3300010042|Ga0126314_10510094 | Not Available | 873 | Open in IMG/M |
| 3300010044|Ga0126310_11729936 | Not Available | 520 | Open in IMG/M |
| 3300010045|Ga0126311_11579653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300010166|Ga0126306_10210596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 1471 | Open in IMG/M |
| 3300010166|Ga0126306_10250905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1350 | Open in IMG/M |
| 3300010166|Ga0126306_10263724 | Not Available | 1318 | Open in IMG/M |
| 3300010166|Ga0126306_10450077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1013 | Open in IMG/M |
| 3300010166|Ga0126306_11151022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300010166|Ga0126306_11716657 | Not Available | 524 | Open in IMG/M |
| 3300010375|Ga0105239_10985010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 969 | Open in IMG/M |
| 3300010399|Ga0134127_11534741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 739 | Open in IMG/M |
| 3300010399|Ga0134127_13097528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300012204|Ga0137374_10004920 | All Organisms → cellular organisms → Bacteria | 15888 | Open in IMG/M |
| 3300012358|Ga0137368_10412331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
| 3300012358|Ga0137368_10644593 | Not Available | 670 | Open in IMG/M |
| 3300012684|Ga0136614_10391958 | Not Available | 1016 | Open in IMG/M |
| 3300012938|Ga0162651_100059649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300015374|Ga0132255_106000965 | Not Available | 514 | Open in IMG/M |
| 3300018081|Ga0184625_10544472 | Not Available | 578 | Open in IMG/M |
| 3300018422|Ga0190265_10197073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2021 | Open in IMG/M |
| 3300018466|Ga0190268_11960285 | Not Available | 536 | Open in IMG/M |
| 3300018469|Ga0190270_10679232 | Not Available | 1018 | Open in IMG/M |
| 3300018469|Ga0190270_11948722 | Not Available | 645 | Open in IMG/M |
| 3300018481|Ga0190271_10171615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
| 3300019377|Ga0190264_10364183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
| 3300019767|Ga0190267_10813712 | Not Available | 623 | Open in IMG/M |
| 3300019767|Ga0190267_11063851 | Not Available | 576 | Open in IMG/M |
| 3300021078|Ga0210381_10205641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 688 | Open in IMG/M |
| 3300025901|Ga0207688_10804112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 596 | Open in IMG/M |
| 3300025927|Ga0207687_10284730 | Not Available | 1326 | Open in IMG/M |
| 3300025932|Ga0207690_10572314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 920 | Open in IMG/M |
| 3300025933|Ga0207706_11189165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 634 | Open in IMG/M |
| 3300025961|Ga0207712_10265666 | Not Available | 1393 | Open in IMG/M |
| 3300027880|Ga0209481_10643024 | Not Available | 550 | Open in IMG/M |
| 3300028722|Ga0307319_10069339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
| 3300028744|Ga0307318_10004647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4431 | Open in IMG/M |
| 3300028771|Ga0307320_10106675 | Not Available | 1067 | Open in IMG/M |
| 3300028782|Ga0307306_10184572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300028889|Ga0247827_11115886 | Not Available | 542 | Open in IMG/M |
| 3300030336|Ga0247826_11055340 | Not Available | 647 | Open in IMG/M |
| 3300031229|Ga0299913_11374454 | Not Available | 662 | Open in IMG/M |
| 3300031858|Ga0310892_10916137 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031944|Ga0310884_10768402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 587 | Open in IMG/M |
| 3300032159|Ga0268251_10017036 | Not Available | 2111 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 41.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.11% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 8.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.85% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_23239271 | 3300000033 | Soil | PPLCDMGDSQRREFHEALLDADAFEDLPGGWQAAVVRSEQNRLKLRLVGSPNAS* |
| ICChiseqgaiiFebDRAFT_136772173 | 3300000363 | Soil | PPLSEMGDLQRRVFHEALLDADNLRRPAWERWQAAIVSAEQNRPQLRVVKED* |
| JGI10213J12805_100225021 | 3300000858 | Soil | PPLSEMSVYQRREFHEALLEVDSFEDLPGKWQAAVLKEEKNRPNLRIVGSD* |
| JGI25407J50210_100027114 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSAEQRREFHEALLDADSFEDLPGKWQAAILKAEQRRPKLRVVSGD* |
| JGI25407J50210_100075935 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MSELQRRELHEALLDADSFEDLPGKWQAAILKAEENRPNLRIVGGD* |
| JGI25407J50210_100504753 | 3300003373 | Tabebuia Heterophylla Rhizosphere | PPLSEMGDRQRREFXEALLEANTFEDLPGKWQATILKAEENRPKLRVVSGD* |
| Ga0062590_1022569382 | 3300004157 | Soil | ELGTDQRREFHEALLDADSVEDLPGKWQAAIVAAEQNSPKLRVVSGD* |
| Ga0063356_1010167732 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGDLRRREFHEALLEAGGFEDLPGKWQAAIMEAEQNPPKLRVVTGE* |
| Ga0063356_1022065031 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EFHEALLDAGSFEDLSGRWQAAIVAAEQNRPQLRLIGSD* |
| Ga0062595_1015842722 | 3300004479 | Soil | QRRECHEALLDADSFEDLPGKWRAAIVQAEQGQPNLRLVRD* |
| Ga0070691_108690311 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDLQRREFHEALLDADSFEDLPGKWQAAIVAAEQRRRRLRIVSGG* |
| Ga0070662_1014600051 | 3300005457 | Corn Rhizosphere | QRREFHEALLETDSFEDPPGKWQAAIVKAEQNRSKLRLIGDD* |
| Ga0070696_1005774202 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGELQRREFHEALLDAGAFEDLPGKWQAAILEAEQNRPQLRVFTSD* |
| Ga0058697_102864641 | 3300005562 | Agave | MSDLQRRDFHEALLDADAFEDLPGKWQAEILKAEENRPKLRIVGTE* |
| Ga0081538_1000192118 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MGDRQRREFHEALLEANTFEDLPGKWQATILKAEENRPKLRVVSGD* |
| Ga0081538_100098634 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MDDPQRREFHEALLDADGFADLPGKWQAAIMKSERNRPNLRIVGSD* |
| Ga0081538_100627742 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSRLQRREFHESLLDSDAFEDLPSKWQAAILKAEENAPNLRIVGAG* |
| Ga0081538_101067104 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSKLERREFHEALLHADGFEDLPGKWQAAILTAEQNRPSLRIVRS |
| Ga0081538_101152743 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTDLERREFHEALPDADAFEDLPGKWQAAIFKAEQNRPKPRLVSDA* |
| Ga0081538_102282192 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSDLQRREFHEALLDADRFEDLSGKWQVAILKAEGNRPNLRIVTS* |
| Ga0075432_103932381 | 3300006058 | Populus Rhizosphere | QRREFHEALLDAGSFEDLPGEWQAAILEAEHNRPKMQVVRTD* |
| Ga0082029_16319832 | 3300006169 | Termite Nest | MAADQRHEFHEALLDADSFEDLPGKWQPAIVKAEQEPPKLRVVNSD* |
| Ga0075428_1000750076 | 3300006844 | Populus Rhizosphere | MNDTQRREFHEALLDAGSFDDLPGKWQAAVVAAEQNRPKLRVVSGD* |
| Ga0075420_1013905321 | 3300006853 | Populus Rhizosphere | VGYPPLCDMGEDQRRECHEALLDADAFEDLPGKWQAAIVTAEQNRPKLRVVSGD* |
| Ga0079217_112414922 | 3300006876 | Agricultural Soil | MDEQPRREFHEALLDADSFEDLPGKWQAAIVTAEQNQPKLRIVRH* |
| Ga0075429_1001768812 | 3300006880 | Populus Rhizosphere | MNDTQRREFHEALLDAGSFDDLPGKWQAAVVAAEQNRPKLRLISND* |
| Ga0114129_108427343 | 3300009147 | Populus Rhizosphere | MSDLQRREFHEALLEAATFEDLPGKWQAAIVLGEQNRPDLRIVGSD* |
| Ga0111538_127438622 | 3300009156 | Populus Rhizosphere | REFQEALLDAHSFEDLPGKWQSAIVSAEQNQPKLRVVSRD* |
| Ga0126307_100055526 | 3300009789 | Serpentine Soil | MGDLQRRDFHEALLEPDTFEDLAGKWQAAIVQTEQNRPTLRLIRSN* |
| Ga0126307_117098111 | 3300009789 | Serpentine Soil | HEALLDADSFEDLPGKWQAAILKAEQNRPPLRVVTSD* |
| Ga0126313_100190539 | 3300009840 | Serpentine Soil | MTGSAAEFQEALLDADSFDDLPGKWQAAILEAEQNRRKLRVVTGD* |
| Ga0126313_100355673 | 3300009840 | Serpentine Soil | MDDRQRREFHEALLDANGFEDLPGKWQAAILEAEVQRPKLRLISDG* |
| Ga0126313_100446962 | 3300009840 | Serpentine Soil | VSWRREFQEALLDAGSFEDLPGKWQAAIVRAEQNRPRLRVIGGD* |
| Ga0126313_101200182 | 3300009840 | Serpentine Soil | MDDGQRREFREALLDADSFENLPGKWQAAILEAEQNRPPLRVVTSDRLAPS* |
| Ga0126313_101689263 | 3300009840 | Serpentine Soil | MDAQQRREFHEALLDARVFDPGKWQAAILNAEAARPRLRLVSRD* |
| Ga0126313_103259932 | 3300009840 | Serpentine Soil | MDDRQRRELHEALLDADGFEDLPGKWQAAILKAEAARPKLRVVSGD* |
| Ga0126313_103628133 | 3300009840 | Serpentine Soil | APQRREFHEARLDAGSFEESAREVAAEQNRPKLRVVRDG* |
| Ga0126313_104203782 | 3300009840 | Serpentine Soil | MDDRQRREFDEALLEAGSFEDLPGKWQAAILKAEQNRPKLRVVTGD* |
| Ga0126313_111800721 | 3300009840 | Serpentine Soil | MSEGQRREFHEALLEAGTFEDLPGKWQAAILQAEQRRPKLRVVVSD* |
| Ga0126313_111866861 | 3300009840 | Serpentine Soil | MDDRQRREFHEALLGAESFEDLPGKWQAAILEAEAGRPRLRVVTGD* |
| Ga0126313_112436742 | 3300009840 | Serpentine Soil | MDDRQRRSSEALLDADALEDLPGKWQAAILKAEAARPQLRVVEGD* |
| Ga0126305_102529431 | 3300010036 | Serpentine Soil | VELDDLQRREFHEALLEAGSFDDLSGKWQAAILQAEQNRPQLRVSSD* |
| Ga0126305_104473461 | 3300010036 | Serpentine Soil | MSDLQRREFHEALLEPASFEDLPRKWQAAILAAEQNRPQRRLVNGD* |
| Ga0126305_109430142 | 3300010036 | Serpentine Soil | MGDLQRRDFHEALLEADTFEDLAGKWQAAIVQTEQNRPTLRLIRSN* |
| Ga0126304_100814381 | 3300010037 | Serpentine Soil | SWDDLQRREFHEALLEAGSFEDLPGKWQAAILEAEQNRPKLRLVTGD* |
| Ga0126304_101714941 | 3300010037 | Serpentine Soil | MDERQRREFDEALLEADSFEDLPGKWQAAILKAEAARPQLRVVEGD* |
| Ga0126304_106072681 | 3300010037 | Serpentine Soil | MSGPSRREFHEALLDADSFEDLPGKWQAAILKAEQNRPNLRVVRDG* |
| Ga0126304_107561673 | 3300010037 | Serpentine Soil | EFHEALLEAGSFDDLSGKWQAAILQAEQNRPQLRVSSD* |
| Ga0126315_100482843 | 3300010038 | Serpentine Soil | MDDRQRREFHEALLEADNFEDLPGKWQAAILKAEAARPELHVVEGE* |
| Ga0126315_103184763 | 3300010038 | Serpentine Soil | VGYPPLVEIDDQQRREFHEALLDADSFEDLPGKWQAAILEAEQNRPKLLLVSDD* |
| Ga0126315_103370271 | 3300010038 | Serpentine Soil | VGYSPLVEMDEKQRREFHEALLDAERFEDLPGKWQAAILEAEAARPQLRVLAGD* |
| Ga0126315_106564972 | 3300010038 | Serpentine Soil | VGYPPLVEMDDRQRRELHEALLDADSFDDLPGKWQAAILKAEAARPLCP* |
| Ga0126315_108985112 | 3300010038 | Serpentine Soil | DDRQRRELHEALLDADGFEDLPGKWQAAILKAEAARPKLRVVSGD* |
| Ga0126315_111717442 | 3300010038 | Serpentine Soil | VGIDDRQRRELHEALLDADSFEDLPGKWEAAILTAEAARPQLRIIDED* |
| Ga0126308_100763404 | 3300010040 | Serpentine Soil | SELGDLHRREFHEALLEAGVFADLPGKWHAAILKAEQARPMLRVVSGD* |
| Ga0126308_102624034 | 3300010040 | Serpentine Soil | VGYPPLSEMGDLQRRDFHEALLEADTFEDLAGKWQAAIVQTEQNRPTLRLIRSN* |
| Ga0126308_107621042 | 3300010040 | Serpentine Soil | SEMGDLQRRDFHEALLEADTFEDLAGKCQAAILKAEQHRPKLRLIRND* |
| Ga0126312_100415837 | 3300010041 | Serpentine Soil | LDDRQRREFQEALLDADSFEDLPGKWQAAILEAEAARPNLRVVPGD* |
| Ga0126312_101072183 | 3300010041 | Serpentine Soil | MDDRQRREFHEALLDAESLEDLPGKWQAAILEAEAARPQLRVVTGE* |
| Ga0126312_101328703 | 3300010041 | Serpentine Soil | MDDGQRREFHEALLDADSFEELPGKWQAAILKAEQNRPKLRIVSRD* |
| Ga0126312_103873991 | 3300010041 | Serpentine Soil | MSYLQKSPEFHQALVDAETFEDLSGKWQAAILKAEQNRPDLRIVG |
| Ga0126312_105204451 | 3300010041 | Serpentine Soil | QRREFHEALLDANGFEDLPGKWQAAILEAEVQRPKLRLISDG* |
| Ga0126314_100564093 | 3300010042 | Serpentine Soil | MGAQQRREFHEALLEAATLEDLPGKWQAAILKAERSRPKLRVIAGA* |
| Ga0126314_102322734 | 3300010042 | Serpentine Soil | HEALLDADSFEDLPGKWQAAILEAEQNRPKLLLVSDD* |
| Ga0126314_105100941 | 3300010042 | Serpentine Soil | MGVAQRREFHESLLGAETFEDLPGNWQAAILKAEQSRPNLRVVRSE* |
| Ga0126310_117299362 | 3300010044 | Serpentine Soil | LVGYPPLCNMGDHQRREFHEALLDAHSFEDLPGKWQAAIVSAEQNQPKLRVVRRG* |
| Ga0126311_115796531 | 3300010045 | Serpentine Soil | ASSTRPCSNADSFEDLPGKWQVAILKAEAARPQLRVVSRD* |
| Ga0126306_102105963 | 3300010166 | Serpentine Soil | MGEQQRREFHEALLDADSFEDLPGKWQAAISKAEQTRPKLRLIRSH* |
| Ga0126306_102509052 | 3300010166 | Serpentine Soil | MGDQQRREFHEALLDAGSFEDLPGKWQAAILKAEQNRPKLRLVTED* |
| Ga0126306_102637241 | 3300010166 | Serpentine Soil | EMSDLQRRLVHEALLEAGSFDDLPGKWQAAILHAEQNRPRLRVVSGD* |
| Ga0126306_104500772 | 3300010166 | Serpentine Soil | MDDRQRREFHEALLEADSFEDLLGKWQAAILKAEQNRPQLRVVTGD* |
| Ga0126306_111510222 | 3300010166 | Serpentine Soil | EVQRREFQEALLEAGTFEGLPGKWQAAILEAEQNRPKLRVVSGG* |
| Ga0126306_117166571 | 3300010166 | Serpentine Soil | MSDQQRREFQEALLAADSIEDLPGECQAAILEAEQNRPKLRIVAGD* |
| Ga0105239_109850102 | 3300010375 | Corn Rhizosphere | MGDDQRREFHEALLDADSFEDLPGKWQAAVVTAEQNRPNLRVVTGD* |
| Ga0134127_115347413 | 3300010399 | Terrestrial Soil | EFHEALLDGDSFEDLLGKWQAAVVKAELNRPKLRLIGDD* |
| Ga0134127_130975281 | 3300010399 | Terrestrial Soil | GYPPLCDMSELQRREFHEALLDADSFEDLPGKWQAAIVTAELNRPQLRLVSSD* |
| Ga0137374_100049203 | 3300012204 | Vadose Zone Soil | MSEEQRREFHEALLEADGFEDLPGKWQAAILKAEQNRPKLRVVSGD* |
| Ga0137368_104123311 | 3300012358 | Vadose Zone Soil | AYPPLSEMGADQRREFQEALLEADSFEDLPGKWQAAVLAAEQNRPTFRVVSSE* |
| Ga0137368_106445931 | 3300012358 | Vadose Zone Soil | GYPPLSEMSEEQRREFHEALLEADGFEDLPGKWQAAILKAEQNRPKLRVVSGD* |
| Ga0136614_103919581 | 3300012684 | Polar Desert Sand | MGDLQRREFHEALLDADGFEDLPGKWQAAILKAEENRPNLRIVDSG* |
| Ga0162651_1000596491 | 3300012938 | Soil | SELDELQRREFDVALLEAETFEDLPGKWQAATLEAEQNRPKLRVV* |
| Ga0132255_1060009651 | 3300015374 | Arabidopsis Rhizosphere | LPLSELGDLQRREFHEALLEADSFEDLPGKWQAAIVEAEQNRPKLKLISND* |
| Ga0184625_105444723 | 3300018081 | Groundwater Sediment | ASKGRQLPPLSELGELQRREFHEALLEDARFEDLAGKWQAAILKAEQNRPKLRLLSSA |
| Ga0190265_101970733 | 3300018422 | Soil | MSDSQRRDFQESLLDDDSFKDLPGKWQASILKAEQNRRKLRPVSDA |
| Ga0190268_119602851 | 3300018466 | Soil | EALLDAHSFEDLPGKWQAAIASAEQNQPKLRLVSRD |
| Ga0190270_106792321 | 3300018469 | Soil | MRLARMRSGACARGAGERSEFHEALLEADAFEDLPGKWQAAILEAEQNRPKLRVV |
| Ga0190270_119487221 | 3300018469 | Soil | GYAPLSELSDLQRREFHDALLEAATFEDLPGKWQAAIVEAEQSRPRLRVVTSD |
| Ga0190271_101716152 | 3300018481 | Soil | MPAEQRREFHEAVLDADDFEDLPGKWQAAILGAEDNRPKLWVVGSD |
| Ga0190264_103641832 | 3300019377 | Soil | MSDSQRRDFQESLLDDDSFEDPPGKWQASILKAEQNRRKLRPVSDA |
| Ga0190267_108137122 | 3300019767 | Soil | MASVELSRRVAFHEALLDAQAFEDLARKWQAATLEEEQNRPDLRVVSDG |
| Ga0190267_110638511 | 3300019767 | Soil | PPLSEMGDLQRREFHEALLEAATFQDLPGRWQAAILEAEQNRPKLRLISSA |
| Ga0210381_102056411 | 3300021078 | Groundwater Sediment | DAAQHRELHEALLDADGFEDLPGKWQAAIVAAEQNRPKLRIFSSD |
| Ga0207688_108041122 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDDQRREFHEALLDADSFEDLPGKWQAAVVTAEQNRPNLRVVTGD |
| Ga0207687_102847301 | 3300025927 | Miscanthus Rhizosphere | MGDLQRREFHEALLDADSFEDLPGKWQAAIVAAEQRRRRLRIVSGG |
| Ga0207690_105723141 | 3300025932 | Corn Rhizosphere | PPLSELGDLQPRESHEALLEAGSFEDLPGRWQAAILAAEQNRR |
| Ga0207706_111891651 | 3300025933 | Corn Rhizosphere | QRREFHEALLETDSFEDPPGKWQAAIVKAEQNRSKLRLIGDD |
| Ga0207712_102656663 | 3300025961 | Switchgrass Rhizosphere | SEMSDGQRREFHEALLEAASFEDLPGKWQAAVVTAEQNRPKLRVVTGD |
| Ga0209481_106430241 | 3300027880 | Populus Rhizosphere | MNDTQRREFHEALLDAGSFDDLPGKWQAAVVAAEQNRPKLRVVSGD |
| Ga0307319_100693392 | 3300028722 | Soil | LSDLQRREFHEALLEADSFEDLPGKWQAAILAAEQNRPKLRVVTGD |
| Ga0307318_100046477 | 3300028744 | Soil | QRRDFHEALLDADTSENLPGKWQAAILKAEENRPKLRLVADL |
| Ga0307320_101066751 | 3300028771 | Soil | HDALPICYPPLSELSDLQRREFHEALLEADSFEDLPGKWQAAILAAEQNRPKLRVVTGD |
| Ga0307306_101845721 | 3300028782 | Soil | EFHEALLEAETLEDLPGKWQAAIIGAEQARPKPPVVTSD |
| Ga0247827_111158861 | 3300028889 | Soil | EMADLQRREFHEALLDAGSFEDLPGKWQEVILKAKQNRPELRVVSGD |
| Ga0247826_110553401 | 3300030336 | Soil | LQRREFHEALLEAGSFEDLPGKWQAPIAKAEQNRPRLRVVTHD |
| Ga0299913_113744541 | 3300031229 | Soil | KKVVASPPLCDMDDTQRREFHEALLDADGFEDLPGKWQAAILEAEQKRPKLRVV |
| Ga0310892_109161372 | 3300031858 | Soil | MGDLQRREFHEALLEAGSFEDLPGWWQAAILKAEQNRPKLRLV |
| Ga0310884_107684022 | 3300031944 | Soil | MGDLQRREFHEALLEAGSFEDLPGWWQATILKAEQNRPKLRLV |
| Ga0268251_100170361 | 3300032159 | Agave | MSDLQRRDFHEALLDADAFEDLPGKWQAEILKAEENRPKLRIVGTE |
| ⦗Top⦘ |