| Basic Information | |
|---|---|
| Family ID | F090837 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATA |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.85 % |
| % of genes near scaffold ends (potentially truncated) | 36.11 % |
| % of genes from short scaffolds (< 2000 bps) | 99.07 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.481 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (25.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.407 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.58% β-sheet: 25.32% Coil/Unstructured: 48.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00216 | Bac_DNA_binding | 17.59 |
| PF02403 | Seryl_tRNA_N | 3.70 |
| PF00902 | TatC | 1.85 |
| PF13586 | DDE_Tnp_1_2 | 0.93 |
| PF00872 | Transposase_mut | 0.93 |
| PF13610 | DDE_Tnp_IS240 | 0.93 |
| PF00903 | Glyoxalase | 0.93 |
| PF13472 | Lipase_GDSL_2 | 0.93 |
| PF13683 | rve_3 | 0.93 |
| PF06685 | DUF1186 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 17.59 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 3.70 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 1.85 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.48 % |
| All Organisms | root | All Organisms | 18.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 25.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 10.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 9.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 6.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.78% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_103620902 | 3300001686 | Soil | MAEIRTESREKDLCTLYIGEQVVIADLTRAEAEALLAVYQRVTHRS* |
| C688J18823_105946541 | 3300001686 | Soil | MAEIRTESSEDDLCTLYIGEQVVITDLTRAEAEAVLAAYLRVTHRMVYA* |
| C688J35102_1182120001 | 3300002568 | Soil | MAKIRTESNEEDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVIHREASA* |
| C688J35102_1186283261 | 3300002568 | Soil | MATIRVESRDEDLCTLLIGDQVVIAGLTRAEAEALLAIYRRVTHQN* |
| C688J35102_1192766722 | 3300002568 | Soil | AEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHQKACARPELRLVS* |
| Ga0063455_1013758511 | 3300004153 | Soil | TESVEEDLCTLYIGEQVVITGLTRAEAEAVLTAYQRVTHRMAYA* |
| Ga0063455_1014269402 | 3300004153 | Soil | NPMAKIRTESNEEDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVIHREASA* |
| Ga0070683_1005045161 | 3300005329 | Corn Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATARS* |
| Ga0070690_1009786861 | 3300005330 | Switchgrass Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPELRLVP* |
| Ga0068869_1008319541 | 3300005334 | Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHREACATA* |
| Ga0070682_1003947132 | 3300005337 | Corn Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHRKACATA* |
| Ga0070689_1012653042 | 3300005340 | Switchgrass Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHRKACATA* |
| Ga0070669_1010910541 | 3300005353 | Switchgrass Rhizosphere | MATIRVESRDEDLCTLLIGDQVVIAGLTRAEAEALLAIYQRVTHQN* |
| Ga0070673_1015495552 | 3300005364 | Switchgrass Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATA* |
| Ga0070701_105962501 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHREACATA* |
| Ga0070700_1007844923 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVMHWKACAAARS* |
| Ga0070663_1004292051 | 3300005455 | Corn Rhizosphere | TESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHRKACATA* |
| Ga0070663_1017381562 | 3300005455 | Corn Rhizosphere | MATIRVESRDEDLCTLLISDQVVIAGLTRAEAEALLAIYRRV |
| Ga0070681_109695421 | 3300005458 | Corn Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATA* |
| Ga0070679_1021318602 | 3300005530 | Corn Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPELRLVS* |
| Ga0068859_1024878931 | 3300005617 | Switchgrass Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKAC |
| Ga0068861_1017439642 | 3300005719 | Switchgrass Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPELRLVP* |
| Ga0068863_1026152751 | 3300005841 | Switchgrass Rhizosphere | VAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHRKACATA* |
| Ga0068860_1005189801 | 3300005843 | Switchgrass Rhizosphere | MATICVESRDEDLCTLLIGDQVVIAGLTRAEAEALLAIYRRVTHQN* |
| Ga0082029_16452203 | 3300006169 | Termite Nest | MATIHTESKDEDLCTLYIGEQVVITGLSRAEAEAVLAVYRRVIRRGV* |
| Ga0097621_1022534471 | 3300006237 | Miscanthus Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAML |
| Ga0079219_105764422 | 3300006954 | Agricultural Soil | MAKIRTESNEEDLCTLYIDEQVVITGLTRAEAEAVLAAYQRVIHREAQA* |
| Ga0105245_119026481 | 3300009098 | Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACAAARS* |
| Ga0105241_117230331 | 3300009174 | Corn Rhizosphere | RREPMAEIRTESREEDLCTLYIGDQIAISDLTRAEAEAMLAAYERVIHRKACATA* |
| Ga0105248_119789362 | 3300009177 | Switchgrass Rhizosphere | MAEIRTESREEDLCTLYIGDQIAISDLTRAEAMLAAYERVMHRKACGRAP |
| Ga0105249_110797662 | 3300009553 | Switchgrass Rhizosphere | MAEIRAESREEDLCTLYIGDQIAISDLTRAEAEAMLAAYER |
| Ga0126307_101107632 | 3300009789 | Serpentine Soil | MAEIRTESIEDDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVTHRMAYA* |
| Ga0126307_102831793 | 3300009789 | Serpentine Soil | MAEIRTDSIEDDLCTLYIGEQVMITGLTRAEAEALLAVYQRVTHRMV* |
| Ga0126307_104705232 | 3300009789 | Serpentine Soil | MAEIRTDSIEDDLCTLYIGEQVVITGLTRAEAEALLAAYQRVTHRMAYA* |
| Ga0126307_106855401 | 3300009789 | Serpentine Soil | PMAEIRTESTEEDLCTLYIGEQVVIADLTRAEVEALLAAYQRVTHRAA* |
| Ga0126307_110433713 | 3300009789 | Serpentine Soil | MAEIRVESRDEDLCTLTIGKQIVITDLTRAQAEALLVAYRRVTHQG* |
| Ga0126313_107055842 | 3300009840 | Serpentine Soil | MAEIRTESSEEDLCTLYIGEQVVITGLTRAEAEALLAAYQRVTHRMV* |
| Ga0126305_104518153 | 3300010036 | Serpentine Soil | MAEIRTESSEEDLCTLYIGEQVVITGLTRAEAEAVLAVYQRVTHQMAYARRLQFRVVP* |
| Ga0126305_107841652 | 3300010036 | Serpentine Soil | MAEIRTESIEDDLCTLYIGEQVVITGLTRAEAEAVLAAYQRV |
| Ga0126304_108418531 | 3300010037 | Serpentine Soil | MAEIRTDSSEDDLCTLYIGEQVMITGLTQAEAEAVLAAYL |
| Ga0126304_111409971 | 3300010037 | Serpentine Soil | MAEICTESSEDGLCTLYIGEQVVISGLTRAEAEAVLTAYLRVTHRMAYA* |
| Ga0126309_101324331 | 3300010039 | Serpentine Soil | MAEIRTESSEEDLCTLYIREKLVIAGLTRAEAEALLAAYQRVTHRS* |
| Ga0126309_102946811 | 3300010039 | Serpentine Soil | MAEIRTDSSEKDVCTLYIGEQVVITGLTRAEAEAVLAAYQRVTHRMAYA* |
| Ga0126309_107529941 | 3300010039 | Serpentine Soil | MAAIRTESTEEDLCTLYIGEQVVIADLTRAEAEALLAAYQRVTHRAA* |
| Ga0126309_108539333 | 3300010039 | Serpentine Soil | MAEIRTESSEDDLCTLYIGEQVVITGLTRAEAEAVLAAYLRVAHRMVYA* |
| Ga0126309_112310702 | 3300010039 | Serpentine Soil | MAEIRTESSEEDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVTHRMAYA* |
| Ga0126308_110280752 | 3300010040 | Serpentine Soil | MAEIRTDSIEDDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVTHRMA |
| Ga0126308_111803341 | 3300010040 | Serpentine Soil | MAEIRTESSEEDLCTLYIGEQVVITGLTRAEAEAVLAVYQRVTHRTA* |
| Ga0126312_104596652 | 3300010041 | Serpentine Soil | MAEIRTESSEDDLCTLYIGEQVMITGLTRAEAEAVLAAYLRVTHRMAYA* |
| Ga0126312_108735331 | 3300010041 | Serpentine Soil | LWREAVAEIRTDSIEDDLCTLYIGEQVLITGLTRAEAEAVLAAYLRVAHRTVYA* |
| Ga0126314_103810832 | 3300010042 | Serpentine Soil | MAEIRTESSEDDLCTLYIGEQVLIAGLTRAEAEAVLAAYLRVT |
| Ga0126314_111226591 | 3300010042 | Serpentine Soil | MAEIRTESIEDDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVTHRMT |
| Ga0126310_107222041 | 3300010044 | Serpentine Soil | MAEIRTESIVDDLCTLYIGEQVVITGLTRAESEAVLATYQRVTHRMAYA* |
| Ga0126311_108377972 | 3300010045 | Serpentine Soil | MAEIRIESRDEDLCTLTIGEQVVIADLTRAQAAALLAVDRRVTHQG* |
| Ga0126311_110171612 | 3300010045 | Serpentine Soil | MAEIHTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVTHRKACATA* |
| Ga0126311_110300592 | 3300010045 | Serpentine Soil | MAEIRTESVEEDLCTLYIGEQVVITGLTRAEAEAVLTAYQRVTHRMAYA* |
| Ga0126311_111676531 | 3300010045 | Serpentine Soil | MVEIHVDSTEEDLCTLYIGKQVVITNLTRGEAEAVLAAYQRVTHRTASA* |
| Ga0126311_118482862 | 3300010045 | Serpentine Soil | MAEIRTDSIKEDVCTLYIGEQIVIAGLTRAEAEAVLAAYLRVTHRMP |
| Ga0126320_10738312 | 3300010146 | Soil | MATIRVELPDEDLCTLLIGDQVVIADLTRAEAEALLAIYRRVTHQN* |
| Ga0126320_14400052 | 3300010146 | Soil | MVEIRTESIEDDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVTYRTTHA* |
| Ga0126306_102015021 | 3300010166 | Serpentine Soil | MAEIRTESSEEDLCTLYIGEQVVITGLTRAEAEALLAVYQRVTHRMV* |
| Ga0134125_110364552 | 3300010371 | Terrestrial Soil | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPDLRLVS* |
| Ga0134127_126555832 | 3300010399 | Terrestrial Soil | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPELRLVS* |
| Ga0134121_103039832 | 3300010401 | Terrestrial Soil | MAEIRAESLDEDVYTLYIGQQVVITWLTRAEAEAVLAAYQRVTHQMRRA* |
| Ga0150985_1001267535 | 3300012212 | Avena Fatua Rhizosphere | MAKIRTESNEEDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVVHRKASAP* |
| Ga0150985_1015891631 | 3300012212 | Avena Fatua Rhizosphere | MAEIRTESREEDLCTLYIGEQVVITGLTRAEAKAVLAAYQRVTHRMVYA* |
| Ga0150985_1049332791 | 3300012212 | Avena Fatua Rhizosphere | REEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACAWPDLRLVS* |
| Ga0150985_1076644501 | 3300012212 | Avena Fatua Rhizosphere | WDVAAIRTEAREEDLCTLYIGGQIMITGLTRAEAEAVLAAYQRVMHRMAHA* |
| Ga0150985_1098083752 | 3300012212 | Avena Fatua Rhizosphere | MAEIRTGSSEEDGCTLYIGEQVVITGLTRAEAVLAAYRRVTHRMAYA* |
| Ga0150985_1104008772 | 3300012212 | Avena Fatua Rhizosphere | MAEIRTESSEDDLCTLYISEQVVITGLTRAEAEAVLAAYLRVTHRMV* |
| Ga0150985_1104266121 | 3300012212 | Avena Fatua Rhizosphere | PMAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHQKACARPELRLVS* |
| Ga0150985_1156583822 | 3300012212 | Avena Fatua Rhizosphere | MAEIRTEPREEDLCTLYIGDQIAISDLTRAEAMLAAYERVIHRKACERPDLRLVS* |
| Ga0150985_1179991672 | 3300012212 | Avena Fatua Rhizosphere | YIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPDLRLVS* |
| Ga0150985_1203927982 | 3300012212 | Avena Fatua Rhizosphere | MAEIRVESRDEDLCTLTIGKQIVIADLTRAQAEALLVAYRRVTHQG* |
| Ga0150985_1222244364 | 3300012212 | Avena Fatua Rhizosphere | EDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPDLRLVS* |
| Ga0150984_1007587591 | 3300012469 | Avena Fatua Rhizosphere | MAAIRTEAREEDLCTLYIGGQIMITGLTRAEAEAVLAAYQRVMHRMAHA* |
| Ga0150984_1022170133 | 3300012469 | Avena Fatua Rhizosphere | EEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVTHRKACATA* |
| Ga0150984_1056301541 | 3300012469 | Avena Fatua Rhizosphere | MAEIRTDSIEDDLCTLYIGEQIVIAGLTRAEAEAVLAAYLRVTHRMPYT* |
| Ga0150984_1061212071 | 3300012469 | Avena Fatua Rhizosphere | PMAEIRTESREEDLCTLYIGDQIAISDLTRAEAEAMLAVYERVIHRKACATARS* |
| Ga0150984_1061248941 | 3300012469 | Avena Fatua Rhizosphere | PMAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVMHRKACAAA* |
| Ga0150984_1076888321 | 3300012469 | Avena Fatua Rhizosphere | EEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVTHRKACATARS* |
| Ga0150984_1157389481 | 3300012469 | Avena Fatua Rhizosphere | MAEIRTESREEDLCTLYIGEQVVIADLTRAEAEALL |
| Ga0150984_1158603901 | 3300012469 | Avena Fatua Rhizosphere | ESSEDDLCTLYIGEQVVITDLTRAEAEAVLAAYLRVTHRMVYA* |
| Ga0150984_1160385511 | 3300012469 | Avena Fatua Rhizosphere | AEIRTDSIEDDLCTLYIGEQVLITGLTRAEAEAVLAAYLRVTHRMAYA* |
| Ga0150984_1161816501 | 3300012469 | Avena Fatua Rhizosphere | TESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPDLRLVS* |
| Ga0163162_103560413 | 3300013306 | Switchgrass Rhizosphere | MVTIRVESRDEDLCTLLIGDQVVIAGLTRAEAEALLAIYRRVTHQN* |
| Ga0157380_106071032 | 3300014326 | Switchgrass Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACARPDLRLVS* |
| Ga0132258_126975782 | 3300015371 | Arabidopsis Rhizosphere | MAEIRTESREEDLCTLYIGDQIAISDLTRAEAEAMLAAYERVIHRKACATA* |
| Ga0163161_114626921 | 3300017792 | Switchgrass Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVTHRKACARPDLRLVS |
| Ga0190269_106745291 | 3300018465 | Soil | MAEIRTESSEDDLCTLYIGEQVMITGLTRAEAVLAAYLRVTHRMAYA |
| Ga0190268_106725591 | 3300018466 | Soil | MAEMRTESSEDDLCTLYIGEQVVITGLTRAEAEAVLAAYLRVTHRMVYA |
| Ga0207656_101330272 | 3300025321 | Corn Rhizosphere | MAEIRAESREEDLCTLYIGDQIAISDLTRAEAEAMLAAYERVMHWKACAAARS |
| Ga0207710_105326802 | 3300025900 | Switchgrass Rhizosphere | VAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRK |
| Ga0207688_103410012 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACAAA |
| Ga0207680_112948902 | 3300025903 | Switchgrass Rhizosphere | MATIRVKSRDEDLCTLLIGDQVVIAGLTRAEAEALLAIYRRVTHQN |
| Ga0207681_114698191 | 3300025923 | Switchgrass Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAA |
| Ga0207659_105641092 | 3300025926 | Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHRKACATA |
| Ga0207687_105709932 | 3300025927 | Miscanthus Rhizosphere | SREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATA |
| Ga0207690_108449531 | 3300025932 | Corn Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHRKACATA |
| Ga0207669_106740652 | 3300025937 | Miscanthus Rhizosphere | MAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHREACATA |
| Ga0207711_115015082 | 3300025941 | Switchgrass Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRK |
| Ga0207689_103426071 | 3300025942 | Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAVYERVIHREACATA |
| Ga0207708_101491393 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIRTESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATA |
| Ga0207641_110102172 | 3300026088 | Switchgrass Rhizosphere | VAEIRAESREEDLCTLYIGEQIAISDLTRAEAEAMLAAYERVIHRKACATA |
| Ga0207675_1010201583 | 3300026118 | Switchgrass Rhizosphere | MATIRVESRDEDLCTLLIGDQVVIAGLTRAEAEALLAIYRRVTHQN |
| Ga0307288_102537892 | 3300028778 | Soil | MAKIRTESNEEDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVIHREASA |
| Ga0308204_103567591 | 3300031092 | Soil | EIRTESREEDLCTLYIGEQVVIADLTRAEAEALLAAYQRVTHRS |
| Ga0307416_1024191241 | 3300032002 | Rhizosphere | MATIRTESKDEDLCTLYIGEQVVITGLTRAEAEAVLAAYQRVIHRGA |
| ⦗Top⦘ |