| Basic Information | |
|---|---|
| Family ID | F090801 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEEELRRVAGIVLRAPLTRRTGRELLYCGIGGLAGVAGFWIT |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.630 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF12730 | ABC2_membrane_4 | 29.63 |
| PF13304 | AAA_21 | 5.56 |
| PF00005 | ABC_tran | 2.78 |
| PF01987 | AIM24 | 1.85 |
| PF01494 | FAD_binding_3 | 0.93 |
| PF09948 | DUF2182 | 0.93 |
| PF13796 | Sensor | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.85 |
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 1.85 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.93 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.93 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027165 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100640051 | 3300001356 | Peatlands Soil | MDDRIRLVAGTVLRAPFTGRTVRELVYCGIGGLAGVAGFYITVFS |
| C688J35102_1206789651 | 3300002568 | Soil | MEDELRRVAGIILGAPLTPWALRDLLYCVFGGLTGLLGFLV |
| JGI26339J46600_100464733 | 3300003218 | Bog Forest Soil | MEEEIRRVAGIILGAPLTRRTRRELLYSGFGGLAGVAGFCLTLVLLTTG |
| JGI26341J46601_100544731 | 3300003219 | Bog Forest Soil | MEEEIRRVAGIVLRAPLTRRTLHELLYCGVGGLAGVAGFLLILVLLTT |
| JGIcombinedJ51221_104597151 | 3300003505 | Forest Soil | MEEEIRRVAGIIVRAPLTRRTLLELLYCGFGGLAGVAGFCL |
| Ga0062385_112371802 | 3300004080 | Bog Forest Soil | MDEDIRRVTGTILRAPLTRRSVNDLLYCGFGGLAGLIGFEIT |
| Ga0062389_1020935402 | 3300004092 | Bog Forest Soil | VEEEIRRVAEIVLHAPLTRRNRRELVYCGFGGAAGVIAFVP |
| Ga0070709_104398722 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSV |
| Ga0068853_1003058783 | 3300005539 | Corn Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVLVVLLLA |
| Ga0070665_1006604853 | 3300005548 | Switchgrass Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFS |
| Ga0066692_109094771 | 3300005555 | Soil | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAGVAGFWITL |
| Ga0066903_1058327531 | 3300005764 | Tropical Forest Soil | VEEELWRVAGIVLRAPLARQTRRDLLYCCVSVLAGVLGF |
| Ga0075015_1005479332 | 3300006102 | Watersheds | MEEEIRRVAGIVLGAPLTRRTRRELLYCGLGGLAGLAGFWLTLVL |
| Ga0075030_1006554921 | 3300006162 | Watersheds | MEEEIRRVAGIVLRAPLTRRTGRELLYCVFGGLAGVAGFWLT |
| Ga0070716_1003146271 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAGVAGFCVTLVL |
| Ga0075021_106852381 | 3300006354 | Watersheds | MEEEIRRVAGIVLRAPLTRRTGRELLYCGFGGLAG |
| Ga0068871_1007063212 | 3300006358 | Miscanthus Rhizosphere | MEDELRRVAGIIVGAPLTRQARRDLLYCLFGGVAGYL |
| Ga0079222_117213412 | 3300006755 | Agricultural Soil | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAGVAGFWITLVLL |
| Ga0099793_103657911 | 3300007258 | Vadose Zone Soil | MEEEFRRVAGIILGAPLTRRTRRELLYCLFGGLAGVAGFVVTLM |
| Ga0116218_13586801 | 3300009522 | Peatlands Soil | MEDAIRRVAGTVLRVPFTGRTVCELVYCGLGGLAGVAGFL |
| Ga0116220_103636111 | 3300009525 | Peatlands Soil | MGEDIRRVAGTVLRAPLTRRTVHELLYCGFGGLAGLAGFW |
| Ga0134064_101855871 | 3300010325 | Grasslands Soil | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAG |
| Ga0136449_1045227201 | 3300010379 | Peatlands Soil | MDEDLRRVAGTVLRAPLTRRTVHELLYCGIGGITGVI |
| Ga0134124_117745371 | 3300010397 | Terrestrial Soil | MESELRRVAGIVFGAPLTRRTRRELLYCLTGGLAGVAGFVLTVL |
| Ga0134127_132916551 | 3300010399 | Terrestrial Soil | MESELRRVAGIVFGAPLTRRTRRELLYCLTGGLAGVAGFVVTVLL |
| Ga0134121_106807621 | 3300010401 | Terrestrial Soil | MEEELRRVASIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVLVVLLL |
| Ga0137388_104561801 | 3300012189 | Vadose Zone Soil | MDDIRRVTGIILRAPLTRRNCRELLYCGFGGLAGVAGFWITV |
| Ga0137370_108858901 | 3300012285 | Vadose Zone Soil | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAGVAGF |
| Ga0137372_103182023 | 3300012350 | Vadose Zone Soil | VEEQIRRVAGLVLQAPLTRRTRRELLYCGIGGLAGLAG |
| Ga0137386_109412661 | 3300012351 | Vadose Zone Soil | VESELRRVTGIILGAPLTRRTRRELLYCLTGGLAGVAGFV |
| Ga0137407_100311091 | 3300012930 | Vadose Zone Soil | MESELRRVAGIVFGAPLTRRTRRELLYCLTGGLAGVA |
| Ga0164301_109297271 | 3300012960 | Soil | MDEEIRRVAGLVLRAPLTRRTRRELLYCGIGGLAGLAGFWVTLGVLLLGLTLS |
| Ga0182008_101198033 | 3300014497 | Rhizosphere | VESELRRVAGIILGAPLTRRTGHELLYCLAGGLAGVVG |
| Ga0187802_104594082 | 3300017822 | Freshwater Sediment | MNEDIRRVTGIILRAPFTRRTVRELLYCGFGGLAGWVGFSIT |
| Ga0187819_100579121 | 3300017943 | Freshwater Sediment | MDDRIWLVAGTILRAPFTGRTVRELVYCGIGGLAGVAGFFITVF |
| Ga0187883_101410983 | 3300018037 | Peatland | MEEEIRRAAGIVLRAPLTRRTLHELLYCGLGGLAGVAGFLLTLVLLT |
| Ga0187772_106744532 | 3300018085 | Tropical Peatland | MDEEIWRVAGLILEAPLTRRNRRELLYCGLGGLAGALGF |
| Ga0187769_110389321 | 3300018086 | Tropical Peatland | MEQAIRRVTGTILRAPFTRRTVRELLYCGLGGAAGVIGFG |
| Ga0066655_102364591 | 3300018431 | Grasslands Soil | MEDELRRVAGIILGAPLTPWALRDLLYCVFGGLTGLLGFLVMVVLLAFGL |
| Ga0210395_101073074 | 3300020582 | Soil | MDEEIRRVAGLIVQAPLTRRNRRELLYCALGGPAGVAGFL |
| Ga0210401_114439991 | 3300020583 | Soil | MDEDIRRVAGTVLRAPFTRRTVRELLYCGIGGITGVIGFSITV |
| Ga0210393_105155072 | 3300021401 | Soil | MDEDIRRVAGTVLRAPFTRRTVRELLYCGIGGITGVIGFSITVVM |
| Ga0210387_117320132 | 3300021405 | Soil | MEEEFRRVAGIVLGAPLARRTRRELLYCGVGGLAGVLGVVLGVVLLAFG |
| Ga0210384_105015563 | 3300021432 | Soil | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAGVVGFC |
| Ga0210390_104662291 | 3300021474 | Soil | MDEDIRRVAGTILGAPLTRRTVRELLYCGVGGLAGVAGFL |
| Ga0126371_126256931 | 3300021560 | Tropical Forest Soil | MEDEIRRVAGIILRAPLTRRNRRELLYCVFGGLAG |
| Ga0247677_10148083 | 3300024245 | Soil | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGF |
| Ga0224564_10537962 | 3300024271 | Soil | MEEEIRRVAGIIVRAPLTRRTLHELLYCGFGGLAG |
| Ga0207692_103008351 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVLVVLL |
| Ga0207710_100392614 | 3300025900 | Switchgrass Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVLVVLLLAG |
| Ga0207685_102165512 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVL |
| Ga0207685_102728852 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDELRRVAGIIVGAPLTRQARRDLLYCLFGGVAGYLGFAV |
| Ga0207695_108221482 | 3300025913 | Corn Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVLVVLLLAGF |
| Ga0207644_103889591 | 3300025931 | Switchgrass Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVA |
| Ga0207709_102897763 | 3300025935 | Miscanthus Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLYCFFGGLAGVAGFSVAV |
| Ga0207677_105677931 | 3300026023 | Miscanthus Rhizosphere | MEEELRRVAGIVLGAPLTRRTRHELLFCFFGGLAGVAGFSVLV |
| Ga0209577_103974792 | 3300026552 | Soil | MEEELRRVASLVLQAPLTRRTRRELLYCGVGGLAGVVGFCVTLVLLAFGL |
| Ga0208608_1021902 | 3300027165 | Forest Soil | MEDEIRRVADTILRAPLTRRTFHELLYCGFGGLAGVVAFPVT |
| Ga0208199_10509714 | 3300027497 | Peatlands Soil | MEDAIRRVAGTVLRVPFTGRTVRELVYCGLGGLAGVAGFLIT |
| Ga0207826_10280831 | 3300027680 | Tropical Forest Soil | MGENVRRVTGTILRAPFTRRTVRELLYCVFGGLAG |
| Ga0209178_14245662 | 3300027725 | Agricultural Soil | MESELRRVAGIVFGAPLTRRTGQELLYCLTGGLAGVA |
| Ga0209448_101093352 | 3300027783 | Bog Forest Soil | MEEEIRRVAGIIVRAPLTRRTLHELLYCGFGGLVG |
| Ga0209166_102128672 | 3300027857 | Surface Soil | MDEDIRRVTGIILSAPFTRRTVNELLYCGLGGIAG |
| Ga0209380_101732133 | 3300027889 | Soil | MDEDIRRVAGTVLRAPLTRRTVHELLYCGFGGIAGVIGF |
| Ga0209526_103233543 | 3300028047 | Forest Soil | MDDIRRVTGIVLGALVTRRTLRELLYCGFGGLAGG |
| Ga0302232_105865982 | 3300028789 | Palsa | MDQDIRRVTGTMLRAPLTRRSVGDLLYCGFGGLAGLIGFEITVVLL |
| Ga0302302_13490761 | 3300029997 | Palsa | MDEDIRRVTGIVLRAPLTHRTVRELLYCGVGGLAGVIG |
| Ga0311353_109735671 | 3300030399 | Palsa | MDEDIRRVTGIVLRAPLTHRTVRELLYCGIGGLAGVIGFEITIAMLA |
| Ga0210251_104882552 | 3300030624 | Soil | MEEEIRRVADTILRAPLTRRTFHELLYCVFGGLVGVVAFP |
| Ga0265760_102257101 | 3300031090 | Soil | MDEDIRRVAGTVLRAPFTRRTVHELLYCGFGGITGVIGFSITVVML |
| Ga0318516_100498941 | 3300031543 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFAVVV |
| Ga0318516_103890622 | 3300031543 | Soil | MGEDIRRVTGTILRAPFTRRTVREMLYCGVGGLAGERGTQD |
| Ga0318534_101390943 | 3300031544 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFVVVVVLLASGL |
| Ga0318534_102449361 | 3300031544 | Soil | MGENVRRVTGTILRAPFSRRTVRELLYCVFGGLAGVAGFWIT |
| Ga0318541_102044371 | 3300031545 | Soil | MGDDIRRVTGIILRAPFTRRTVRELLYCGVGGVAGVAGFLITVLM |
| Ga0318555_104449152 | 3300031640 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFAVVVVLLAAG |
| Ga0318561_105576852 | 3300031679 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFVVVVVLL |
| Ga0318572_107684361 | 3300031681 | Soil | MGDDIRRVTGTILRAPFTRRTVRELLYCGLGGLAGAIGFWITIVM |
| Ga0318560_108121121 | 3300031682 | Soil | MDEEIWRVAGLILEAPLTRRNRRELLYCGLGGLAGALGFYI |
| Ga0318496_106874831 | 3300031713 | Soil | MGDDVRRVTGTILRAPLTLRTVRELLYCGFGGLAGAIGFLIT |
| Ga0306918_112120681 | 3300031744 | Soil | MTDDFRRVAGIIVRAPFTRRTGRELLYCGFGGVAGVAGFLITVVML |
| Ga0318494_101447731 | 3300031751 | Soil | VEEELWRVAGIVLRAPLARQTRRELLYCGVGALAGVLGFLVTVVLLALGLTV |
| Ga0307475_105218891 | 3300031754 | Hardwood Forest Soil | MDEDIRRVAGTVLRAPFTRRTVRELLYCGFGGITGVIGFS |
| Ga0318554_106487782 | 3300031765 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFAVVVVL |
| Ga0318548_106107601 | 3300031793 | Soil | MDEDIRRVAGTILRAPFTRRTVRELLYCGFGGLAGAIGFLITIV |
| Ga0318565_104434881 | 3300031799 | Soil | MEEEIWRVAGLILEAPLTRRNRRELLYCGLGGLAGALGFWILVAL |
| Ga0318567_101305213 | 3300031821 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFVVVVVL |
| Ga0318567_102418311 | 3300031821 | Soil | VGENVRRVTGTILRAPFTRRTVRELLYCVFGGLAGVAGFWIT |
| Ga0318499_102864681 | 3300031832 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGT |
| Ga0318544_102759531 | 3300031880 | Soil | MGDDIRRVTGTILRAPFTRRTVRELLYCGVAGVAG |
| Ga0318559_103508981 | 3300032039 | Soil | MGEDIRRVTGTILRAPFTRRTVREMLYCGVGGLAGV |
| Ga0318570_100275721 | 3300032054 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFVVV |
| Ga0318570_103857082 | 3300032054 | Soil | MEEEFRRVAGIVLGAPLARRTRRELLYCGVGGLAGVLGFALVVVLLALGLTV |
| Ga0318514_105822111 | 3300032066 | Soil | MEDEIRRVATLILEAPLTRRTRRELLYCGLGGAAGVAGFWVTMV |
| Ga0306924_126136752 | 3300032076 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFVV |
| Ga0318525_102833391 | 3300032089 | Soil | MGEDIRRMTGTILRAPLTRRTVQELLYCGFGGIAG |
| Ga0311301_101150087 | 3300032160 | Peatlands Soil | VAGIVLRAPLTRRTGRELLYCGIGGLAGVAGFWITVILLTAGF |
| Ga0311301_109040771 | 3300032160 | Peatlands Soil | MEEELRRVAGIVLRAPLTRRTGRELLYCGIGGLAGVAGFWIT |
| Ga0307472_1009229802 | 3300032205 | Hardwood Forest Soil | MDEEIRRVAGLILRAPLTRRTRRELLYCGIGGLAGLA |
| Ga0310812_105509252 | 3300032421 | Soil | VESELRRVAGIILGAPLARRTGHELLYCLAGGLAGVAGFV |
| Ga0335082_112300502 | 3300032782 | Soil | VEEEIRRVAGLVLQAPLTRRTRRELLYCGIGGLAGLA |
| Ga0335070_102879523 | 3300032829 | Soil | MEEEIRRVAGIVLTAPLARRTRRELLYCGLGGLAG |
| Ga0335070_104193381 | 3300032829 | Soil | MDEEIRRVAGLILEAPLARRNRRELLYCGLGGLAGA |
| Ga0335072_110370201 | 3300032898 | Soil | VEEELWRVAGIVLRAPLARQTRRDLLYCGVSMLAGVLGFLVIV |
| Ga0335076_115522362 | 3300032955 | Soil | MDEEIRRVAGLILEAPLTRRNRRELLYCGLGGLAGALGFWILVALLAF |
| Ga0335077_103757791 | 3300033158 | Soil | VEEELWRVAGIVLRAPLARQTRRDLLYCGVSMLAGVLGFVVVVVLL |
| Ga0335077_109350174 | 3300033158 | Soil | MEEEFGRVAGIVLGAPLARRTRRELLYCGVGGLAGT |
| Ga0318519_110034671 | 3300033290 | Soil | MEEELRRLAGIILAAPLDRRTRRELLYCGVGGLAGTLGFAVV |
| ⦗Top⦘ |