| Basic Information | |
|---|---|
| Family ID | F090797 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 45 residues |
| Representative Sequence | QVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.85 % |
| % of genes near scaffold ends (potentially truncated) | 97.22 % |
| % of genes from short scaffolds (< 2000 bps) | 95.37 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.741 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.704 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.185 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.88% Coil/Unstructured: 65.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF13344 | Hydrolase_6 | 11.11 |
| PF00221 | Lyase_aromatic | 11.11 |
| PF00196 | GerE | 6.48 |
| PF00857 | Isochorismatase | 3.70 |
| PF00903 | Glyoxalase | 2.78 |
| PF02423 | OCD_Mu_crystall | 1.85 |
| PF07087 | DUF1353 | 1.85 |
| PF04321 | RmlD_sub_bind | 1.85 |
| PF13424 | TPR_12 | 0.93 |
| PF00561 | Abhydrolase_1 | 0.93 |
| PF12681 | Glyoxalase_2 | 0.93 |
| PF03704 | BTAD | 0.93 |
| PF02317 | Octopine_DH | 0.93 |
| PF02574 | S-methyl_trans | 0.93 |
| PF00202 | Aminotran_3 | 0.93 |
| PF07730 | HisKA_3 | 0.93 |
| PF00743 | FMO-like | 0.93 |
| PF04545 | Sigma70_r4 | 0.93 |
| PF02558 | ApbA | 0.93 |
| PF11774 | Lsr2 | 0.93 |
| PF01261 | AP_endonuc_2 | 0.93 |
| PF00296 | Bac_luciferase | 0.93 |
| PF04961 | FTCD_C | 0.93 |
| PF13460 | NAD_binding_10 | 0.93 |
| PF00872 | Transposase_mut | 0.93 |
| PF00909 | Ammonium_transp | 0.93 |
| PF13602 | ADH_zinc_N_2 | 0.93 |
| PF07859 | Abhydrolase_3 | 0.93 |
| PF13376 | OmdA | 0.93 |
| PF00581 | Rhodanese | 0.93 |
| PF13191 | AAA_16 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 11.11 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 3.70 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 3.70 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 3.70 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.70 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 3.70 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 1.85 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 1.85 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.93 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.93 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.93 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.93 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.93 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.93 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.93 |
| COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 0.93 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.93 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.93 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.93 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.74 % |
| Unclassified | root | N/A | 9.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E02HGTBC | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300005332|Ga0066388_101417186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
| 3300005332|Ga0066388_102990205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 864 | Open in IMG/M |
| 3300005332|Ga0066388_108456163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300005435|Ga0070714_100686310 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005435|Ga0070714_101291046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300005436|Ga0070713_101162650 | Not Available | 746 | Open in IMG/M |
| 3300005471|Ga0070698_101560726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300005541|Ga0070733_11050482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300005718|Ga0068866_11378960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter coccineus | 514 | Open in IMG/M |
| 3300005764|Ga0066903_101586008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300005764|Ga0066903_101586276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300005764|Ga0066903_106195581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300006173|Ga0070716_100349874 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300006175|Ga0070712_100106588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2084 | Open in IMG/M |
| 3300006871|Ga0075434_101413786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300009100|Ga0075418_11201530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 822 | Open in IMG/M |
| 3300009683|Ga0116224_10330783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300009698|Ga0116216_10765213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300010046|Ga0126384_10328399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300010046|Ga0126384_11690392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300010047|Ga0126382_12132738 | Not Available | 537 | Open in IMG/M |
| 3300010048|Ga0126373_12646002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300010048|Ga0126373_12716449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300010359|Ga0126376_10536712 | Not Available | 1091 | Open in IMG/M |
| 3300010359|Ga0126376_10630335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1019 | Open in IMG/M |
| 3300010359|Ga0126376_11151117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300010360|Ga0126372_10852254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 908 | Open in IMG/M |
| 3300010360|Ga0126372_12499681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
| 3300010360|Ga0126372_13318313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300010362|Ga0126377_13592866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300010366|Ga0126379_10908745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia cypriaca | 983 | Open in IMG/M |
| 3300010366|Ga0126379_13396043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300010376|Ga0126381_102143571 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010376|Ga0126381_104281702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300010379|Ga0136449_101348773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
| 3300011269|Ga0137392_10998034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300012929|Ga0137404_10469333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola algeriensis | 1119 | Open in IMG/M |
| 3300012971|Ga0126369_12944131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300013306|Ga0163162_13098201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300014162|Ga0181538_10520706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300015052|Ga0137411_1057058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300016270|Ga0182036_10076669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2199 | Open in IMG/M |
| 3300016319|Ga0182033_10042681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3007 | Open in IMG/M |
| 3300016319|Ga0182033_10122768 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300016387|Ga0182040_11562230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300017932|Ga0187814_10113500 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300017932|Ga0187814_10320498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300017970|Ga0187783_10240380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1325 | Open in IMG/M |
| 3300021088|Ga0210404_10210923 | Not Available | 1044 | Open in IMG/M |
| 3300021406|Ga0210386_10519121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300021432|Ga0210384_10202507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1784 | Open in IMG/M |
| 3300021479|Ga0210410_10208076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1752 | Open in IMG/M |
| 3300021560|Ga0126371_10265830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1834 | Open in IMG/M |
| 3300021560|Ga0126371_10579587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
| 3300021560|Ga0126371_11281179 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300024232|Ga0247664_1109428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300025898|Ga0207692_10082232 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300025898|Ga0207692_10102583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1573 | Open in IMG/M |
| 3300025898|Ga0207692_10904128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300025905|Ga0207685_10145589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1067 | Open in IMG/M |
| 3300025910|Ga0207684_10011174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7861 | Open in IMG/M |
| 3300025915|Ga0207693_10139869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1904 | Open in IMG/M |
| 3300025916|Ga0207663_10972794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300025949|Ga0207667_10362190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1479 | Open in IMG/M |
| 3300027846|Ga0209180_10333001 | Not Available | 867 | Open in IMG/M |
| 3300027869|Ga0209579_10674917 | Not Available | 560 | Open in IMG/M |
| 3300027884|Ga0209275_10779541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300028884|Ga0307308_10200845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300030494|Ga0310037_10199511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300030511|Ga0268241_10171733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300031549|Ga0318571_10111778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300031549|Ga0318571_10382065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300031564|Ga0318573_10447977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300031668|Ga0318542_10568299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300031679|Ga0318561_10086646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1629 | Open in IMG/M |
| 3300031679|Ga0318561_10764299 | Not Available | 531 | Open in IMG/M |
| 3300031680|Ga0318574_10245187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300031681|Ga0318572_10980559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300031682|Ga0318560_10825735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300031708|Ga0310686_101121343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300031723|Ga0318493_10507392 | Not Available | 667 | Open in IMG/M |
| 3300031724|Ga0318500_10279556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300031736|Ga0318501_10534990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300031744|Ga0306918_11250358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300031765|Ga0318554_10255317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 998 | Open in IMG/M |
| 3300031768|Ga0318509_10335328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300031771|Ga0318546_10195024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1381 | Open in IMG/M |
| 3300031797|Ga0318550_10105631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1331 | Open in IMG/M |
| 3300031798|Ga0318523_10110948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1351 | Open in IMG/M |
| 3300031835|Ga0318517_10102207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1259 | Open in IMG/M |
| 3300031890|Ga0306925_10312396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vastitatis | 1690 | Open in IMG/M |
| 3300031897|Ga0318520_11071042 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031910|Ga0306923_10484387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → unclassified Euzebyales → Euzebyales bacterium | 1400 | Open in IMG/M |
| 3300031912|Ga0306921_12117758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300031947|Ga0310909_10160313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1854 | Open in IMG/M |
| 3300031954|Ga0306926_11248252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 870 | Open in IMG/M |
| 3300031954|Ga0306926_11369652 | Not Available | 822 | Open in IMG/M |
| 3300032009|Ga0318563_10326398 | Not Available | 830 | Open in IMG/M |
| 3300032054|Ga0318570_10601794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300032065|Ga0318513_10688278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300032066|Ga0318514_10313880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300032076|Ga0306924_10287550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1887 | Open in IMG/M |
| 3300032089|Ga0318525_10031638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2579 | Open in IMG/M |
| 3300032089|Ga0318525_10366997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300032174|Ga0307470_10617297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300032261|Ga0306920_102242935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300032770|Ga0335085_12452272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_00839240 | 2189573000 | Grass Soil | GSRSRSGRPVLRRGRGPSLASRRGIDAWRNVGDTSAQCLWVLRD |
| Ga0066388_1014171862 | 3300005332 | Tropical Forest Soil | LVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0066388_1029902051 | 3300005332 | Tropical Forest Soil | SSGRPVLRRGETLLASRRGIDGWRNMGESDAQCLWVLRD* |
| Ga0066388_1084561632 | 3300005332 | Tropical Forest Soil | LVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGESDAQCLWVLRD* |
| Ga0070714_1006863101 | 3300005435 | Agricultural Soil | VQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0070714_1012910461 | 3300005435 | Agricultural Soil | KGAELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0070713_1011626501 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GAELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0070698_1015607261 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGSGRPVLRRGETLLAGRRGIDAWRNVGESDAQCLWVLRD* |
| Ga0070733_110504822 | 3300005541 | Surface Soil | QVLLSSGRPVLRRGETLLASRRGIDGWRNVGEGDAQCLWVLRD* |
| Ga0068866_113789601 | 3300005718 | Miscanthus Rhizosphere | PFAHKGAELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0066903_1015860082 | 3300005764 | Tropical Forest Soil | VLRRGETLLASRRGIDGWRNMGESDAQCLWVLRD* |
| Ga0066903_1015862761 | 3300005764 | Tropical Forest Soil | SGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0066903_1061955812 | 3300005764 | Tropical Forest Soil | GRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0070716_1003498741 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0070712_1001065881 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWILRD* |
| Ga0075434_1014137861 | 3300006871 | Populus Rhizosphere | PVLRRGETLLASRRGIDAWRNVGDTGAQCLWVLRD* |
| Ga0075418_112015301 | 3300009100 | Populus Rhizosphere | ILRRGETLLASRRGINGWRNMGESEAQCLWVLRD* |
| Ga0116224_103307831 | 3300009683 | Peatlands Soil | LIQVLLSSGRPVLRRGETLLASRRGINGWRNVGEGDAQCLWVLRD* |
| Ga0116216_107652131 | 3300009698 | Peatlands Soil | AELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNVGEGDAQCLWVLRD* |
| Ga0126384_103283991 | 3300010046 | Tropical Forest Soil | VLRRGETLLASRRGIDGWRNVGDTEAQCLWVLRD* |
| Ga0126384_116903921 | 3300010046 | Tropical Forest Soil | APVGVVNRLVQGLAGCGRPVLRRGETLLASRRGVEGWRNVGETDAQCLWVLRD* |
| Ga0126382_121327382 | 3300010047 | Tropical Forest Soil | LASGRPVLRRGETLLASRRGIDAWRNVGDTGAQCLWVLRD* |
| Ga0126373_126460021 | 3300010048 | Tropical Forest Soil | IQVLLTSGRPILRRGETLLASLRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0126373_127164491 | 3300010048 | Tropical Forest Soil | QVLLSSGRPVLRRGETLLASRRGIDGWRNMGESDAQCLWVLRD* |
| Ga0126376_105367122 | 3300010359 | Tropical Forest Soil | ELVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0126376_106303351 | 3300010359 | Tropical Forest Soil | SGRPVLRRGETLLASRRGIDAWRNVGDTSAQCIWVLRD* |
| Ga0126376_111511171 | 3300010359 | Tropical Forest Soil | QVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0126372_108522542 | 3300010360 | Tropical Forest Soil | SSGRPVLRRGETLLASRRGIDGWRNVGEGDAQCLWVLRD* |
| Ga0126372_124996811 | 3300010360 | Tropical Forest Soil | GRPVLRRGETLLASRRGIDAWRNVGDTSAQCLWVLRD* |
| Ga0126372_133183132 | 3300010360 | Tropical Forest Soil | GLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0126377_135928662 | 3300010362 | Tropical Forest Soil | ASGRPVLRRGETLLASRRGIDAWRNVGDTSAQCIWVLRD* |
| Ga0126379_109087452 | 3300010366 | Tropical Forest Soil | VQVLLSSGRPVLRRGETLLASRRGINGWRNMGEGDAQCLWVLRD* |
| Ga0126379_133960432 | 3300010366 | Tropical Forest Soil | GLVQVQVGSGRPVLRRGETLLASRRAIDAWRNVGDTEAQCLWVLRD* |
| Ga0126381_1021435712 | 3300010376 | Tropical Forest Soil | GAELVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0126381_1042817022 | 3300010376 | Tropical Forest Soil | LLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWILRD* |
| Ga0136449_1013487733 | 3300010379 | Peatlands Soil | VPFAHKGAELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNVGEGDAQCLWVLRD* |
| Ga0137392_109980342 | 3300011269 | Vadose Zone Soil | IQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0137404_104693331 | 3300012929 | Vadose Zone Soil | AELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0126369_129441311 | 3300012971 | Tropical Forest Soil | QVMLASGRPVLRRGETLLASRRGIDAWRNVGDTSAQCLWVLRD* |
| Ga0163162_130982012 | 3300013306 | Switchgrass Rhizosphere | GVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0181538_105207061 | 3300014162 | Bog | VVNGLVQVLLSSGRPVLRRGETLLASRRGIDAWRNVGDSSAQCLWVLRD* |
| Ga0137411_10570581 | 3300015052 | Vadose Zone Soil | VVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD* |
| Ga0182036_100766693 | 3300016270 | Soil | GLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0182033_100426815 | 3300016319 | Soil | LVQVLLGSGRPVLRRGETLLATRRGIDGWRNVGESEAQCLWVLRD |
| Ga0182033_101227681 | 3300016319 | Soil | SGLVKVLLSSGRPVLRRGGALLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0182040_115622301 | 3300016387 | Soil | GRPVLRRGETLLASRRGIDAWRNVGDTSAQCLWVLRD |
| Ga0187814_101135002 | 3300017932 | Freshwater Sediment | VVIGSGRPVLRRGETLLATRRGIDGWRNAGDGDAQCIWVLRD |
| Ga0187814_103204981 | 3300017932 | Freshwater Sediment | RPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0187783_102403802 | 3300017970 | Tropical Peatland | GLIQVLLSSGRPVLRRGETLLASRRGIDGWRNVGEIDAQCLWILRD |
| Ga0210404_102109231 | 3300021088 | Soil | HKGAELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0210386_105191211 | 3300021406 | Soil | AHKGAELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0210384_102025074 | 3300021432 | Soil | LLSSGRPVRRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0210410_102080763 | 3300021479 | Soil | IQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0126371_102658304 | 3300021560 | Tropical Forest Soil | GLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0126371_105795872 | 3300021560 | Tropical Forest Soil | LLSSGRPVLRRGETLLASRRGIDGWRNMGESDAQCLWILRD |
| Ga0126371_112811793 | 3300021560 | Tropical Forest Soil | GRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0247664_11094281 | 3300024232 | Soil | SGLIQVLLSSGRPILRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0207692_100822322 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AVIGPPVLRRGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0207692_101025834 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0207692_109041281 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0207685_101455892 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RPVLRSGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0207684_100111747 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QVLVGSGRPVLRRGETLLASRRGIDAWRNVGDSDAQCLWVLRD |
| Ga0207693_101398691 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0207663_109727941 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0207667_103621903 | 3300025949 | Corn Rhizosphere | VLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0209180_103330012 | 3300027846 | Vadose Zone Soil | GSGRPVLRRGETLLASRRGIDGWRNVGETEAQCLWVLRD |
| Ga0209579_106749171 | 3300027869 | Surface Soil | KGTELVGVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNVGEGDAQCLWVLRD |
| Ga0209275_107795411 | 3300027884 | Soil | GVVSGLIQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0307308_102008452 | 3300028884 | Soil | VQVVLGSGRPVLRRGETLLASRRGIDAWRNVGESDAQCLWVLRD |
| Ga0310037_101995112 | 3300030494 | Peatlands Soil | LSSGRPVLRRGETLLASRRGINGWRNVGEGDAQCLWVLRD |
| Ga0268241_101717332 | 3300030511 | Soil | GVELVAVVGGLVQVLLESGRPVLRRGETLLAERTAVLGWRNVGESEATLFWILRDD |
| Ga0318571_101117782 | 3300031549 | Soil | VNGLVQVLLGSGRPVLRRGETLLASRRGIDGWRNVGDADAQCIWVLRD |
| Ga0318571_103820651 | 3300031549 | Soil | SSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318573_104479771 | 3300031564 | Soil | GRPVLRSGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0318542_105682992 | 3300031668 | Soil | QVLLSSGRPVLRSGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318561_100866461 | 3300031679 | Soil | TELVGVVNGLVQILLSSGRPVLRRGETLLASRRGIDGWRNVGDTDAQCIWVLRD |
| Ga0318561_107642992 | 3300031679 | Soil | QVLLSSGRPVLRSGETLLASRRGIDGWRNMGDGDAQCLWVLRD |
| Ga0318574_102451872 | 3300031680 | Soil | AHKGTELVGVVNGLVQVLLGSGRPVLRRGETLLASRRGIDGWRNVGDADAQCIWVLRD |
| Ga0318572_109805591 | 3300031681 | Soil | GRPVLRRGETLLASRRGIDGWRNVGESDAQCLWVLRD |
| Ga0318560_108257351 | 3300031682 | Soil | AELVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0310686_1011213432 | 3300031708 | Soil | VLLSSGRPVLRRGETLLASRRGIDGWRNAGEGDAQCLWVLRD |
| Ga0318493_105073921 | 3300031723 | Soil | PVLRRGETLLASRRGIDGWRNVGESDAQCLWVLRD |
| Ga0318500_102795561 | 3300031724 | Soil | AHKGAELVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318501_105349901 | 3300031736 | Soil | LLSSGRPVLRSGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0306918_112503582 | 3300031744 | Soil | PVLRRGETLLASRRGIDAWRNVGDTSAQCLWVLRD |
| Ga0318554_102553172 | 3300031765 | Soil | VEAPFAHKGAELVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318509_103353283 | 3300031768 | Soil | VLLSSGRPVLRSGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0318546_101950243 | 3300031771 | Soil | HKGTELVGVVNGLVQVLLGSGRPVLRRGETLLASRRGIDGWRNVGDADAQCIWVLRD |
| Ga0318550_101056311 | 3300031797 | Soil | APFAHKGTELVGVVNGLVQVLLGSGRPVLRRGETLLASRRGIDGWRNVGDADAQCIWVLR |
| Ga0318523_101109482 | 3300031798 | Soil | QVLLSSGRPVLRRGETHLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318517_101022072 | 3300031835 | Soil | VVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0306925_103123961 | 3300031890 | Soil | PVLRSGETLLASRRGIDGWRNMGEGDAQCLWILRD |
| Ga0318520_110710422 | 3300031897 | Soil | DGLYWGDNVQVVPGSGPPVLRRGETLLASPCGIDAWRIAGDTSAQCLRVLRD |
| Ga0306923_104843871 | 3300031910 | Soil | PVLRSGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0306921_121177582 | 3300031912 | Soil | VQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0310909_101603133 | 3300031947 | Soil | GLVQVIVGPGRPVLRRGETLLATRRGIDGWRNAGDSDAQCLWVLRD |
| Ga0306926_112482522 | 3300031954 | Soil | EAPFAHKGAELVGVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0306926_113696522 | 3300031954 | Soil | PVLRRGETLLASRRGIDGWRNVGDTDAQCIWVLRD |
| Ga0318563_103263982 | 3300032009 | Soil | ILLSSGRPVLRRGERRAVSRRGIDGWRNVGDTDAQCIWVLRD |
| Ga0318570_106017942 | 3300032054 | Soil | GVVNGLVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318513_106882781 | 3300032065 | Soil | LVQVIVGPGRPVLRRGETLLATRRGIDGWRNAGDSDAQCLWVLRD |
| Ga0318514_103138801 | 3300032066 | Soil | KGTELVGVVNGLVQVLLGSGRPVLRRGETLLASRRGIDGWRNVGDADAQCIWVLRD |
| Ga0306924_102875503 | 3300032076 | Soil | ELVGVVNGLVQILLSSGRPVLRRGETLLASRRGIDGWRNVGDTDAQCIWVLRD |
| Ga0318525_100316381 | 3300032089 | Soil | LVQVLLSSGRPVLRRGETLLASRRGIDGWRNMGEGDAQCLWVLRD |
| Ga0318525_103669971 | 3300032089 | Soil | RPVLRRGETLLASRRGIDGWRNVGDADAQCIWVLRD |
| Ga0307470_106172971 | 3300032174 | Hardwood Forest Soil | RPVLRRGETLLASRRGIDGWRNMGDGDAQCLWVLRD |
| Ga0306920_1022429351 | 3300032261 | Soil | VGPGRPVLRRGETLLATRRGIDGWRNAGDSDAQCLWVLRD |
| Ga0335085_124522722 | 3300032770 | Soil | ASGRPVLRRGETLLASRRGIDGWRNVGDTSAQCLWVLRD |
| ⦗Top⦘ |