| Basic Information | |
|---|---|
| Family ID | F090793 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ARQHTLIVERGVSFAAFDERGRPLRTAYASNIFAPQARYLIDIR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.37 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.296 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (7.407 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.148 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 5.56% Coil/Unstructured: 94.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF03548 | LolA | 82.41 |
| PF00275 | EPSP_synthase | 2.78 |
| PF00263 | Secretin | 1.85 |
| PF02201 | SWIB | 0.93 |
| PF00152 | tRNA-synt_2 | 0.93 |
| PF13432 | TPR_16 | 0.93 |
| PF07719 | TPR_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 82.41 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.30 % |
| Unclassified | root | N/A | 3.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908041|P3_CLC_ConsensusfromContig21442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 2166559005|cont_contig51230 | Not Available | 855 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1084678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300000956|JGI10216J12902_124243342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300001686|C688J18823_11003147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300004153|Ga0063455_101562759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005093|Ga0062594_103131425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005293|Ga0065715_10371600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300005332|Ga0066388_105979447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300005339|Ga0070660_100036466 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300005367|Ga0070667_100273147 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300005434|Ga0070709_11009771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300005436|Ga0070713_102131755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005526|Ga0073909_10180900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300005555|Ga0066692_10113684 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300005563|Ga0068855_101965157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005569|Ga0066705_10604891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300005713|Ga0066905_100498694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300005764|Ga0066903_100156637 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
| 3300005921|Ga0070766_10765536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300006032|Ga0066696_10124714 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300006032|Ga0066696_10211355 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300006047|Ga0075024_100511867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300006049|Ga0075417_10143688 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300006173|Ga0070716_100406839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300006237|Ga0097621_101343417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300006354|Ga0075021_10926992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300006854|Ga0075425_101055777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300006871|Ga0075434_101706394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300006881|Ga0068865_101530097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300006904|Ga0075424_100749321 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300006904|Ga0075424_101121940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300006914|Ga0075436_100342017 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300009012|Ga0066710_101450012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300009012|Ga0066710_103863800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300009093|Ga0105240_11587183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300009098|Ga0105245_12393301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300009101|Ga0105247_10645250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300009143|Ga0099792_11134993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009156|Ga0111538_12439879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300009553|Ga0105249_12938538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300009553|Ga0105249_13530305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010048|Ga0126373_11562472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300010321|Ga0134067_10238889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300010401|Ga0134121_10538007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300011269|Ga0137392_10431236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300012199|Ga0137383_11124533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012212|Ga0150985_117315650 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012350|Ga0137372_10501576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300012358|Ga0137368_10302774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300012908|Ga0157286_10316199 | Not Available | 577 | Open in IMG/M |
| 3300012930|Ga0137407_11776539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300012955|Ga0164298_10936873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300012971|Ga0126369_10021499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5176 | Open in IMG/M |
| 3300013297|Ga0157378_10616788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300013306|Ga0163162_10084612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3248 | Open in IMG/M |
| 3300014150|Ga0134081_10096564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300015371|Ga0132258_11971689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300015372|Ga0132256_102482917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300015374|Ga0132255_103668266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300018028|Ga0184608_10470713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300018060|Ga0187765_11247563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300018468|Ga0066662_10900568 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 868 | Open in IMG/M |
| 3300018482|Ga0066669_10156480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1685 | Open in IMG/M |
| 3300019377|Ga0190264_11724943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300024182|Ga0247669_1064298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300025167|Ga0209642_10305862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300025315|Ga0207697_10168933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300025903|Ga0207680_10125065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1687 | Open in IMG/M |
| 3300025905|Ga0207685_10676868 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300025908|Ga0207643_11123013 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025915|Ga0207693_10660928 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300025921|Ga0207652_10473572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1128 | Open in IMG/M |
| 3300025927|Ga0207687_10275302 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300025928|Ga0207700_11339905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300025935|Ga0207709_11761624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300025937|Ga0207669_10053030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2440 | Open in IMG/M |
| 3300025939|Ga0207665_10886157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300025940|Ga0207691_10190987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
| 3300025942|Ga0207689_11620894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300026041|Ga0207639_10851437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300026118|Ga0207675_101077389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300026550|Ga0209474_10287088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300027633|Ga0208988_1145046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300027835|Ga0209515_10060051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2819 | Open in IMG/M |
| 3300027873|Ga0209814_10465857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300027874|Ga0209465_10339139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300028379|Ga0268266_10036642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 4176 | Open in IMG/M |
| 3300028596|Ga0247821_10859249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300028784|Ga0307282_10469079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300028819|Ga0307296_10279131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300028828|Ga0307312_11070430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300028884|Ga0307308_10495621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300029636|Ga0222749_10481565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300031561|Ga0318528_10813726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031720|Ga0307469_10468119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300031720|Ga0307469_11442985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300031740|Ga0307468_101225868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300032003|Ga0310897_10357817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300032009|Ga0318563_10340816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300032180|Ga0307471_102066111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300032954|Ga0335083_11076238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300033480|Ga0316620_11336548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300033486|Ga0316624_10247536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1413 | Open in IMG/M |
| 3300034257|Ga0370495_0301018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300034820|Ga0373959_0006982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1890 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.41% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_CLC_01094640 | 2124908041 | Soil | RSHTLIVERGVSFAAFDGDGRPLRAGYAANLFAPQPRYLVRP |
| cont_0230.00003790 | 2166559005 | Simulated | HTLIVERGVSFAAFDDHGTALLTAYASNIYGPQARYLIDSRYR |
| AP72_2010_repI_A001DRAFT_10846782 | 3300000893 | Forest Soil | GHVVANRRHTLIVERGVSFVAFDAGGAPIHTAYRANIFAPQPRFLCYR* |
| JGI10216J12902_1242433422 | 3300000956 | Soil | FGHVIAARQHTLIVERGVSFVTFDERGKPISTVYVSNIFAPQRRFLLR* |
| C688J18823_110031471 | 3300001686 | Soil | VERGISFAAFDQYGGTIRSAYRSNIYAPQARYLIDISPLR* |
| Ga0063455_1015627591 | 3300004153 | Soil | AHRHTLIVERGISFVAFDDHGQPLRTVYLANIFAPEPRYIASIRQ* |
| Ga0062594_1031314251 | 3300005093 | Soil | VAGRHHALIVERGISFAALDRTGRAIRTAYAANIFSAQPRYLIRTGR* |
| Ga0065715_103716002 | 3300005293 | Miscanthus Rhizosphere | VAARQHTLIVERGVSFVAFDASGRPLRSAYASNIFAPQPRYLVRLAE* |
| Ga0066388_1059794471 | 3300005332 | Tropical Forest Soil | IVERGVSFAAFDAVGRPMQTVYASNIFAPQPRYLVSIAE* |
| Ga0070660_1000364661 | 3300005339 | Corn Rhizosphere | RQHTLIVERGLSFAAFDDRGRALRVAYAANLFAPQPRYLIHER* |
| Ga0070667_1002731471 | 3300005367 | Switchgrass Rhizosphere | NRRHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR* |
| Ga0070709_110097712 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FGQVVADRRHALIVERGISLVVLDSNGRALRTVYASNIFAPQPRYLVR* |
| Ga0070713_1021317552 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVVANRQHTLIVERGISFAAFDDRGAVLRTEYASNIYAPQPRYLIDSRYR* |
| Ga0073909_101809001 | 3300005526 | Surface Soil | ERGVSFAALDRTGRAIRTAYAANIFSAQPRYLIRTGR* |
| Ga0066692_101136843 | 3300005555 | Soil | ERGVSFAAFDATGRDLRVGYSASVFAPQPRYLVR* |
| Ga0068855_1019651572 | 3300005563 | Corn Rhizosphere | IVERGLSFAAFDDRGRPIRTAYAANLFAPQPRFLVRAP* |
| Ga0066705_106048911 | 3300005569 | Soil | HRHTLIVERGISFVAFDDQGRAILTAYRSNIFAPQRRYLIEPQR* |
| Ga0066905_1004986941 | 3300005713 | Tropical Forest Soil | VIAARQHTLIVERGISFAAFDDRGQPIRTAYAANIFAPQARFRVAHR* |
| Ga0066903_1001566371 | 3300005764 | Tropical Forest Soil | AARRHTLIVERGLSFAAFDERGRALTTAYVGNIFAPEPRYLVRALQSPADAR* |
| Ga0070766_107655361 | 3300005921 | Soil | LIVERGISFVAFDASGVPIRTAYAAGIFAPLPRYIVERR* |
| Ga0066696_101247143 | 3300006032 | Soil | HHTLIVERGVSFAAFDDHGVAVTTAYASNIFAPQPRYLVRFAAP* |
| Ga0066696_102113553 | 3300006032 | Soil | LIVERGVSFAAFDAAGRPLRTAYASNIFAPQPRYLVSTNVAVQ* |
| Ga0075024_1005118672 | 3300006047 | Watersheds | GISFAAFDDLGTAVRTAYASNIFAPQARYLIDMAARRP* |
| Ga0075417_101436883 | 3300006049 | Populus Rhizosphere | VERGVSFVAFDRSGLALRTAYAANIFAPQPRYLIRVGNVKVER* |
| Ga0070716_1004068391 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HTLIVERGVSFAAFDAGGRPVRTAYASNIFAPQPRYLVSAAAAPR* |
| Ga0097621_1013434171 | 3300006237 | Miscanthus Rhizosphere | VVAARQHTLIVERGASFVAFDGWGRALRTAYEGNIFAAQPRYLIKIARGIVDP* |
| Ga0075021_109269922 | 3300006354 | Watersheds | AHQHTLIVERGVSFASFDERGAAIRTAYASNIYAPQARYLIANRDR* |
| Ga0075425_1010557771 | 3300006854 | Populus Rhizosphere | QHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR* |
| Ga0075434_1017063942 | 3300006871 | Populus Rhizosphere | IVERGVSFAALDHTGRAMRTAYAANIFSPQPRYLIRTGNVKVE* |
| Ga0068865_1015300971 | 3300006881 | Miscanthus Rhizosphere | AHHHTLIVERGVSFVAFDSSGRAIRMAYASNIFAPQARYLIRSR* |
| Ga0075424_1007493211 | 3300006904 | Populus Rhizosphere | VADRTHTLIVERGVSFAAFNDHGQPIRTAYAANIFAPQPRYLCYR* |
| Ga0075424_1011219401 | 3300006904 | Populus Rhizosphere | TLIVERGVSFAAFDRGGQPLRTAYASNIFAPQPRYLVSTRVESQ* |
| Ga0075436_1003420171 | 3300006914 | Populus Rhizosphere | VIAARQHTLIVERGVSFVAFDDRGRPLRTAYFANLFAPERRYLIRAF* |
| Ga0066710_1014500121 | 3300009012 | Grasslands Soil | ARRRHTLIVERGVSFTAFDRAGRSIRTAYAANIFAPQPRYLIREPAKP |
| Ga0066710_1038638002 | 3300009012 | Grasslands Soil | VVAGRRHTLIVERGVSFAAFDESGKTQRTAYASNIFAPQPRYLVDIRR |
| Ga0105240_115871831 | 3300009093 | Corn Rhizosphere | ERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRYR* |
| Ga0105245_123933012 | 3300009098 | Miscanthus Rhizosphere | GHVIAAHQHTLIVERGVSFAAFDDGGRPLRTAYASNIFAPQARYLIDIR* |
| Ga0105247_106452501 | 3300009101 | Switchgrass Rhizosphere | IVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR* |
| Ga0099792_111349931 | 3300009143 | Vadose Zone Soil | SFVAFGESGQALTTAYASNIFAPQARYLVSIARP* |
| Ga0111538_124398791 | 3300009156 | Populus Rhizosphere | HTLILERGISFVAFDAAGSPLNTAYAANLFAPETRYLIKLTHPGP* |
| Ga0105249_129385382 | 3300009553 | Switchgrass Rhizosphere | GHVIAARQHALIVERGVSFVAFDDRGTATRTAYASNIFAPQARYLIDIARQ* |
| Ga0105249_135303051 | 3300009553 | Switchgrass Rhizosphere | TLIMERGVSLVAFDQSGRSIETGYASGIFAPQPRYLCYR* |
| Ga0126373_115624721 | 3300010048 | Tropical Forest Soil | IVERGVSFVAFDAQGRAIRTAYDANVFAAQTRYVLAPG* |
| Ga0134067_102388891 | 3300010321 | Grasslands Soil | ISFVAFDDQGRAILTAYRSNIFAPQRRYLIEPQR* |
| Ga0134121_105380071 | 3300010401 | Terrestrial Soil | VGRRHALIVERGVSFVAFDRTGQPLRTVYQANIFAPEPRYLVRGR* |
| Ga0137392_104312363 | 3300011269 | Vadose Zone Soil | AARQHTLIVERGVSFAAFDAGGHALTTAYASNIFAPQARYLVSIAPP* |
| Ga0137383_111245331 | 3300012199 | Vadose Zone Soil | IVERGVSFVAFDANGQPSRTAYRSNIFAPQPRYLIRRTDGAP* |
| Ga0150985_1173156502 | 3300012212 | Avena Fatua Rhizosphere | AHRHTLIVERGISFVAFDAHGVPIRTAYRSNIFAPQSRYLIDTGQ* |
| Ga0137372_105015761 | 3300012350 | Vadose Zone Soil | MGFGHVIAGRQHTLIVDRGVSFVAFDDRGKPICSAYASYIFAPQRRFIVLR* |
| Ga0137368_103027743 | 3300012358 | Vadose Zone Soil | IAGRQHTLIVERGVSFVAFDERGKPIRTAYSSNIFAPQRRFLLR* |
| Ga0157295_102756151 | 3300012906 | Soil | HVIAARHHALIVERGVSLVAFDQSGRSIESGYAAGIFAPQPRYLCYR* |
| Ga0157286_103161991 | 3300012908 | Soil | QHTLIIERGVSFVAFDAAGQPMRTAYAANIFAPQARYVIR* |
| Ga0137407_117765391 | 3300012930 | Vadose Zone Soil | VSFASFDDHGSAIRTAYASNIYAPQARYLIDNRDR* |
| Ga0164298_109368731 | 3300012955 | Soil | HVIAAHQHTLIIERGISFAAFDQRGGTIQSAYRSNIYAPQARYLIDIAAVR* |
| Ga0126369_100214995 | 3300012971 | Tropical Forest Soil | LIVERGLSLAAFDERGRAQTTAYAGNIFAPEPRYLVRLAR* |
| Ga0157378_106167881 | 3300013297 | Miscanthus Rhizosphere | TLIVERGVSFVAFDASGRPLRSGYVAGIFAPQPRYLIKMERGIVDP* |
| Ga0163162_100846124 | 3300013306 | Switchgrass Rhizosphere | IVERGISFAALDDRGAALRTEYASNIYAPQPRYLIDSRSR* |
| Ga0134081_100965641 | 3300014150 | Grasslands Soil | HVVAAHRHTLIVERGISFVAFDDQGRAILTAYRSNIFAPQRRYLIEPQR* |
| Ga0132258_119716891 | 3300015371 | Arabidopsis Rhizosphere | TLIVERGVSFATFDATGEPLTRAYFAGIFARQARYLVGAAW* |
| Ga0132256_1024829172 | 3300015372 | Arabidopsis Rhizosphere | HTLIVERGVSFAAFDDRGQPIRTAYAANIFAPQPRFVVRR* |
| Ga0132255_1036682662 | 3300015374 | Arabidopsis Rhizosphere | ERGVSFVGFDDRGQPIRTAYAANLFSPQPRYVVGR* |
| Ga0184608_104707131 | 3300018028 | Groundwater Sediment | RGVSFAAFDSSGRAVRMAYASNIFAPQARYLIRARP |
| Ga0187765_112475632 | 3300018060 | Tropical Peatland | VERGVSFVAFEASGLAIHTTYRSNIFAPQPRFLCYR |
| Ga0066662_109005681 | 3300018468 | Grasslands Soil | TLIVERGVSFATFDRDGRPTRTTYVANIFARQPRFLVRR |
| Ga0066669_101564802 | 3300018482 | Grasslands Soil | LIVERGVSFAAFDESGKTQRTAYASNIFAPQPRYLVDIRR |
| Ga0190264_117249431 | 3300019377 | Soil | RHHALIVERGVSFVAIDSSGRAVHTAYAAGIFAPEPRYLVQLRP |
| Ga0247669_10642982 | 3300024182 | Soil | QHTLIVERGVSFVAFDAAGRPLRTTYASNIFAPQPRYLVRIAE |
| Ga0209642_103058621 | 3300025167 | Soil | VIAGRRHTLIVERGVSFVAFDDQGHSIRTAYASNIFAPQPRFLVQPR |
| Ga0207697_101689333 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | AHRHTLIVERGVSFAAFDEAGVPLRTAYASNIFAPQARYLIDIAP |
| Ga0207688_103627051 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVIAARRHTLIVERGVSFAAFDERGAPLHTAYTANIFAPQPRYLIDIASGIRHDP |
| Ga0207680_101250653 | 3300025903 | Switchgrass Rhizosphere | GHVGANRQHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRYR |
| Ga0207685_106768682 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAHHHTLIVERGVSFAAFDAAGRPLRTAYASSIFAPQPRYLVSTRIESQ |
| Ga0207643_111230131 | 3300025908 | Miscanthus Rhizosphere | ERGVSFAALDSAGRAIRTAYASNIFAPQARYLIRTRQ |
| Ga0207693_106609282 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAVSIQDIVERGVSFVAFDRTGQPLRTVYQANIFAPEPRYLVRGR |
| Ga0207652_104735723 | 3300025921 | Corn Rhizosphere | RQHTLIVERGLSFAAFDDRGRPIRTAYAANLFAPQPRFLVRAP |
| Ga0207687_102753021 | 3300025927 | Miscanthus Rhizosphere | VIVARQHTLIVERGVSFAAFDEHGAAIKTAYASSIYAPQARYLIDSGR |
| Ga0207700_113399052 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GHVVANRQHTLIVERGISFAAFDDRGAVLRTEYASNIYAPQPRYLIDSRYR |
| Ga0207709_117616241 | 3300025935 | Miscanthus Rhizosphere | GHVVAARQHTLIVERGASFVAFDGSGRPLRTGYDGNIFAAQPRYLIKIARGIVDP |
| Ga0207669_100530301 | 3300025937 | Miscanthus Rhizosphere | LIVERGVSFAAFDERGVPLRTAYASNIFAPQARYLIDIR |
| Ga0207665_108861571 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRHTLIVERGVSFAAFDAGGRPVRTAYASNIFAPQPRYLVSAAAAPR |
| Ga0207691_101909873 | 3300025940 | Miscanthus Rhizosphere | RHTLIVERGVSFAAFDERGTPLRTAYAANIFAPQPRYLIDIASGIRHDP |
| Ga0207689_116208941 | 3300025942 | Miscanthus Rhizosphere | RGVSFAAFDDGGRPLRTAYASNIFAPQARYLIDIR |
| Ga0207639_108514371 | 3300026041 | Corn Rhizosphere | TLIVERSISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR |
| Ga0207675_1010773891 | 3300026118 | Switchgrass Rhizosphere | IVERGVSFAAFDSSGRAIRTAYASNIFAPQARHLIRTRH |
| Ga0209474_102870881 | 3300026550 | Soil | RHHTLIVERGVSFAAFDAAGRPLRTAYASNIFAPQPRYLVSTNVAVQ |
| Ga0208988_11450461 | 3300027633 | Forest Soil | HRHTLIVERGVSFAAFDSSGRAVRMAYASNIFAPQPRYLIRARQ |
| Ga0209515_100600511 | 3300027835 | Groundwater | RHHTLIVERGVSFVAFDDSGRARRTGYAANIFAPQPRYLVRTAGGSG |
| Ga0209814_104658571 | 3300027873 | Populus Rhizosphere | IVERGVSFVAFDRSGLALRTAYAANIFAPQPRYLIRVGNVKVER |
| Ga0209465_103391392 | 3300027874 | Tropical Forest Soil | QHTLIVERGISFAAFDDRGTALRTDYASNIYAPQPRYLIDSRHW |
| Ga0268266_100366425 | 3300028379 | Switchgrass Rhizosphere | HTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR |
| Ga0247821_108592491 | 3300028596 | Soil | HTLIVERGVSFAAFDERGAPLHTAYTANIFAPQPRYLIDIASGIRHDP |
| Ga0307282_104690792 | 3300028784 | Soil | AHHHTLIVERGVSFAAFDSSGRAVRMAYASNIFAPQPRYLIRTRQ |
| Ga0307296_102791312 | 3300028819 | Soil | AAHRHTLIVERGVSFAAFDSSGRAVRTAYASNIFAPQPRYLIRARQ |
| Ga0307312_110704301 | 3300028828 | Soil | QVVAGRRHTLIVERGVSFAAFDRTGRPIRMAYAANIFAPQPRYLIREPAPP |
| Ga0307308_104956212 | 3300028884 | Soil | AHHHALIVERGVSFAAFDADGRAVRLAYSAGLFAPQPRYLIRR |
| Ga0222749_104815651 | 3300029636 | Soil | LIVERGVSFASFAGDGRALTTAYASSIFAPLERYLIDSRP |
| Ga0318528_108137262 | 3300031561 | Soil | LIVERGISFVAFDDRGAALRTEYASNIYAPQARYLIDSRYR |
| Ga0307469_104681191 | 3300031720 | Hardwood Forest Soil | RGVSFVALDNGGRAILTAYESNIFAPQPRYLIDIRP |
| Ga0307469_114429851 | 3300031720 | Hardwood Forest Soil | ARQHTLIVERGVSFAAFDAAGRPLRTAYASSIFAPQPRYLVSTRIESQ |
| Ga0307468_1012258682 | 3300031740 | Hardwood Forest Soil | GRRHTLIVERGVSFAAFDEQGRPLRTAYAANIFAPQPRYLIDIAR |
| Ga0310897_103578171 | 3300032003 | Soil | IERGVSFVAFDAGGQPIRTAYAANIFAPQPRYLIR |
| Ga0318563_103408161 | 3300032009 | Soil | GISFVAFDDRGAALRTQYASNIYAPQARYLIDSRYR |
| Ga0307471_1020661111 | 3300032180 | Hardwood Forest Soil | ARRHTLIVERGISFAAFDDHGMALRTAYASNIYAPQARYLIGSRYR |
| Ga0335083_110762381 | 3300032954 | Soil | IVERGVSFVAFDANGTAIHTAYRSNIFAPQPRFLCYR |
| Ga0316620_113365482 | 3300033480 | Soil | HHHALIVERGVSFAAFDASGRPLRTAYAASLFAPERRYLVSEGRP |
| Ga0316624_102475363 | 3300033486 | Soil | AHHHALIVERGVSFAAFDASGRPLRTAYAASIFAPERRYLVSEGRP |
| Ga0370495_0301018_397_531 | 3300034257 | Untreated Peat Soil | ARQHTLIVERGVSFAAFDERGRPLRTAYASNIFAPQARYLIDIR |
| Ga0373959_0006982_1750_1890 | 3300034820 | Rhizosphere Soil | AARQHTLIVERGVSFVAFDPSGRPLRTAYRSNIFAPQPRYLVRLAE |
| ⦗Top⦘ |