Basic Information | |
---|---|
Family ID | F090768 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | MAHAATTRLQKPLPLGTAMLSNIALSLFLWNIAFRIAGLLLAA |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.33 % |
% of genes near scaffold ends (potentially truncated) | 26.85 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.519 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.630 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.185 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (78.704 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF01464 | SLT | 28.70 |
PF02803 | Thiolase_C | 10.19 |
PF02900 | LigB | 1.85 |
PF07746 | LigA | 1.85 |
PF00211 | Guanylate_cyc | 1.85 |
PF00144 | Beta-lactamase | 1.85 |
PF01266 | DAO | 0.93 |
PF04392 | ABC_sub_bind | 0.93 |
PF04444 | Dioxygenase_N | 0.93 |
PF00872 | Transposase_mut | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 10.19 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.85 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.85 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.85 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.93 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.93 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.52 % |
Unclassified | root | N/A | 6.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_119985897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
3300002914|JGI25617J43924_10120123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10008049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3330 | Open in IMG/M |
3300004080|Ga0062385_10161024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1171 | Open in IMG/M |
3300004152|Ga0062386_100127468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1973 | Open in IMG/M |
3300004631|Ga0058899_12175534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 998 | Open in IMG/M |
3300005167|Ga0066672_10747259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300005175|Ga0066673_10028893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2644 | Open in IMG/M |
3300005187|Ga0066675_10200034 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300005332|Ga0066388_102312812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 973 | Open in IMG/M |
3300005363|Ga0008090_15813823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 963 | Open in IMG/M |
3300005434|Ga0070709_10003396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 8554 | Open in IMG/M |
3300005435|Ga0070714_100078935 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
3300005435|Ga0070714_102442008 | Not Available | 508 | Open in IMG/M |
3300005436|Ga0070713_100064544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3073 | Open in IMG/M |
3300005454|Ga0066687_10300635 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300005569|Ga0066705_10030288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2901 | Open in IMG/M |
3300005576|Ga0066708_10303083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
3300005587|Ga0066654_10368847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
3300005764|Ga0066903_107994484 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005921|Ga0070766_10004879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6777 | Open in IMG/M |
3300005921|Ga0070766_10100001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1716 | Open in IMG/M |
3300006173|Ga0070716_101345224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
3300006175|Ga0070712_100013912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5152 | Open in IMG/M |
3300006755|Ga0079222_10929559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
3300006797|Ga0066659_10712690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
3300006800|Ga0066660_10542648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 976 | Open in IMG/M |
3300009038|Ga0099829_10198995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1620 | Open in IMG/M |
3300009792|Ga0126374_11434370 | Not Available | 564 | Open in IMG/M |
3300010048|Ga0126373_10291905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1622 | Open in IMG/M |
3300010048|Ga0126373_10335621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1519 | Open in IMG/M |
3300010048|Ga0126373_10672810 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300010343|Ga0074044_10677295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
3300010358|Ga0126370_10487489 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300010361|Ga0126378_10492830 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300010366|Ga0126379_11507362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
3300010376|Ga0126381_105033111 | Not Available | 507 | Open in IMG/M |
3300010398|Ga0126383_10803359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
3300012198|Ga0137364_10283276 | Not Available | 1228 | Open in IMG/M |
3300012200|Ga0137382_10281255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1158 | Open in IMG/M |
3300012212|Ga0150985_105187147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1915 | Open in IMG/M |
3300012285|Ga0137370_10177490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1242 | Open in IMG/M |
3300016294|Ga0182041_10648106 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300016319|Ga0182033_10692382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
3300016371|Ga0182034_10554068 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300018433|Ga0066667_11126539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300018468|Ga0066662_10263420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1419 | Open in IMG/M |
3300018468|Ga0066662_10405779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1200 | Open in IMG/M |
3300020579|Ga0210407_10201190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1547 | Open in IMG/M |
3300020580|Ga0210403_10004930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11414 | Open in IMG/M |
3300020582|Ga0210395_10207096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1471 | Open in IMG/M |
3300020582|Ga0210395_10714741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300020583|Ga0210401_10223078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1743 | Open in IMG/M |
3300020583|Ga0210401_10259407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1598 | Open in IMG/M |
3300021088|Ga0210404_10091112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1521 | Open in IMG/M |
3300021170|Ga0210400_10012408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6813 | Open in IMG/M |
3300021171|Ga0210405_11057365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
3300021180|Ga0210396_11007121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
3300021358|Ga0213873_10064552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 998 | Open in IMG/M |
3300021362|Ga0213882_10025884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2250 | Open in IMG/M |
3300021377|Ga0213874_10234802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
3300021404|Ga0210389_10068767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2714 | Open in IMG/M |
3300021404|Ga0210389_10466592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
3300021405|Ga0210387_10166750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1895 | Open in IMG/M |
3300021407|Ga0210383_10278752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1436 | Open in IMG/M |
3300021407|Ga0210383_10537279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1009 | Open in IMG/M |
3300021407|Ga0210383_10899990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
3300021420|Ga0210394_10911278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
3300021432|Ga0210384_10727054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 888 | Open in IMG/M |
3300021479|Ga0210410_10078901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2891 | Open in IMG/M |
3300021479|Ga0210410_10321086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1389 | Open in IMG/M |
3300021559|Ga0210409_10701981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
3300021560|Ga0126371_10068636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3441 | Open in IMG/M |
3300021560|Ga0126371_10445737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1440 | Open in IMG/M |
3300021560|Ga0126371_10536341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1319 | Open in IMG/M |
3300021560|Ga0126371_11176337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 904 | Open in IMG/M |
3300022498|Ga0242644_1043035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
3300022531|Ga0242660_1029220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1099 | Open in IMG/M |
3300022720|Ga0242672_1010574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1108 | Open in IMG/M |
3300022724|Ga0242665_10006315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2189 | Open in IMG/M |
3300022724|Ga0242665_10115199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 814 | Open in IMG/M |
3300025898|Ga0207692_10931733 | Not Available | 572 | Open in IMG/M |
3300026322|Ga0209687_1055258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1287 | Open in IMG/M |
3300026355|Ga0257149_1006717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1430 | Open in IMG/M |
3300026527|Ga0209059_1016075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3395 | Open in IMG/M |
3300026550|Ga0209474_10194611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1295 | Open in IMG/M |
3300026551|Ga0209648_10143174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1898 | Open in IMG/M |
3300026551|Ga0209648_10396932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 908 | Open in IMG/M |
3300026552|Ga0209577_10143531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1885 | Open in IMG/M |
3300027047|Ga0208730_1020074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
3300027069|Ga0208859_1004963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1419 | Open in IMG/M |
3300027073|Ga0208366_1000267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2977 | Open in IMG/M |
3300027737|Ga0209038_10052540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1220 | Open in IMG/M |
3300027767|Ga0209655_10158846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
3300027812|Ga0209656_10297962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
3300027824|Ga0209040_10125168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1420 | Open in IMG/M |
3300027824|Ga0209040_10497676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300031231|Ga0170824_103334791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2524 | Open in IMG/M |
3300031474|Ga0170818_107824668 | Not Available | 974 | Open in IMG/M |
3300031474|Ga0170818_114518312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
3300031543|Ga0318516_10136162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1407 | Open in IMG/M |
3300031564|Ga0318573_10222439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1004 | Open in IMG/M |
3300031679|Ga0318561_10331182 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300031679|Ga0318561_10762272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
3300031912|Ga0306921_11113347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
3300031981|Ga0318531_10259978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
3300032001|Ga0306922_11597838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300032261|Ga0306920_104049465 | Not Available | 531 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.63% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.70% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1199858971 | 3300002568 | Soil | MADAATTRLQQPLPRGTAMLSNIALSLFLWNITFRIAGLLLAT* |
JGI25617J43924_101201232 | 3300002914 | Grasslands Soil | MAHAATTRLQKPLPLGTAMLSNIALSLFLWNIAFRIAGLLLAA* |
JGIcombinedJ51221_100080495 | 3300003505 | Forest Soil | MTQAATTRLRQPLPLGTAXLSHIALSLLLWNLTFRIVGWLXAA* |
Ga0062385_101610242 | 3300004080 | Bog Forest Soil | MAHAATTRLQKPLPLGTAMLLNIALSLLMWNIALRIVSLLLAT* |
Ga0062386_1001274684 | 3300004152 | Bog Forest Soil | MALAVTTRSEEPLPLGTAMLSNIALSLFMWNIALRIAGLLLAA* |
Ga0058899_121755343 | 3300004631 | Forest Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLLAA* |
Ga0066672_107472592 | 3300005167 | Soil | MEHVATRRLGKPLPLGTAMLSNIALSLLMWNIALRIAGLLLA* |
Ga0066673_100288933 | 3300005175 | Soil | MAHAATTRLQEPLPPDTAILSTIALSLFLWIIALRIAGLLLAA* |
Ga0066675_102000341 | 3300005187 | Soil | MAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA* |
Ga0066388_1023128122 | 3300005332 | Tropical Forest Soil | GNSMERVATRWLGEPLPLGTAMLCNLALSLLMWNVSLRLALMLAA* |
Ga0008090_158138231 | 3300005363 | Tropical Rainforest Soil | MEHVVTRRSAEPLPLGTAMLSNFALSLLMWNIALRIAGLLLA* |
Ga0070709_100033967 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHAIRTRSKEPLPLGMAMLSNIALSLFMWNLALRIVGLLFAE* |
Ga0070714_1000789353 | 3300005435 | Agricultural Soil | MQHAAMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA* |
Ga0070714_1024420081 | 3300005435 | Agricultural Soil | MERVVARRLDEPLPLSTAMLSNIALSLLMWNIALRIADLLLTA* |
Ga0070713_1000645441 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHAATTRLQQPLPLGTAMLSNIALSLFLWNITFRIAGLLLAA* |
Ga0066687_103006352 | 3300005454 | Soil | MKHVATRRLAEPLPLGMAMLSNVALSLLMWNITLRIAGLLLA* |
Ga0066705_100302881 | 3300005569 | Soil | MAHAAITRLQEPLPLDTAMLSTIALSLFLWNIALRIAGLLLAA* |
Ga0066708_103030832 | 3300005576 | Soil | MAHAAITRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA* |
Ga0066654_103688472 | 3300005587 | Soil | MAHAATTRLQEPLPPDTAILSTIALSLFLWNIALRIAGLLLAA* |
Ga0066903_1079944842 | 3300005764 | Tropical Forest Soil | VEEGNPMESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA* |
Ga0070766_100048793 | 3300005921 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLILVA* |
Ga0070766_101000012 | 3300005921 | Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLLGA* |
Ga0070716_1013452241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHAATTRLQQPLPLGTAMLSNVALSLFLWNITFR |
Ga0070712_1000139125 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHAATTRLQRPLPLGTAMLSNIALSLFLWNITFRIAGLLLAA* |
Ga0079222_109295592 | 3300006755 | Agricultural Soil | MAHAATTRLQQPLPLGTAMLSNIALSLFLWNVTFRIAGLLLAA* |
Ga0066659_107126901 | 3300006797 | Soil | KHVATRRLAEPLPLGMAMLSNVALSLLMWNITLRIAGLLLA* |
Ga0066660_105426482 | 3300006800 | Soil | VKRRSLMAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA* |
Ga0099829_101989953 | 3300009038 | Vadose Zone Soil | MSQAVIKSSEELLPLGTAVLGNLALSLLMWNIALRAAILLVRGMGTLSL* |
Ga0126374_114343701 | 3300009792 | Tropical Forest Soil | MEHVATRRVGKSLPLGSAILFNIVLSMWIIVLRIAGLLLPA* |
Ga0126373_102919051 | 3300010048 | Tropical Forest Soil | MERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA* |
Ga0126373_103356213 | 3300010048 | Tropical Forest Soil | LPRAAEEGNSMERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA* |
Ga0126373_106728103 | 3300010048 | Tropical Forest Soil | LRAALPREVEEGNPMESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA* |
Ga0074044_106772952 | 3300010343 | Bog Forest Soil | MAHAAITPLQEPLPLGMAMLSNIALSLLMWNIALRIVSLLLAA* |
Ga0126370_104874892 | 3300010358 | Tropical Forest Soil | MESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA* |
Ga0126378_104928301 | 3300010361 | Tropical Forest Soil | ATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA* |
Ga0126379_115073621 | 3300010366 | Tropical Forest Soil | ERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA* |
Ga0126381_1050331111 | 3300010376 | Tropical Forest Soil | MERVATKRLGEPLPLGTAMLSNFALSLFMWNVALRVAGLLLA* |
Ga0126383_108033592 | 3300010398 | Tropical Forest Soil | MESVATKCLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA* |
Ga0137364_102832763 | 3300012198 | Vadose Zone Soil | MKYVATRRLAEPLPLGTAMLSNVALSLLMWNIALR |
Ga0137382_102812551 | 3300012200 | Vadose Zone Soil | MKYVATRRLAERLPLGTAMLSNVALSLLMWNIALRIAGLLLA* |
Ga0150985_1051871471 | 3300012212 | Avena Fatua Rhizosphere | MAHAATTRLQEPLPAGTAMLSNIALSLFLWNITFRIAGLLLAA* |
Ga0137370_101774902 | 3300012285 | Vadose Zone Soil | MEHVATRRLAKPLPLGTAMLSNIALSLFMWNIALRIAGLLLA* |
Ga0182041_106481062 | 3300016294 | Soil | MESVATKWLGEPLPPGTAMFSNFALSLFMWNVALRLAGLLLA |
Ga0182033_106923821 | 3300016319 | Soil | MESVATKWLGEPLPPGTAMLSNLALSLFMWNDALRLAG |
Ga0182034_105540683 | 3300016371 | Soil | MESVATKWLGEPLPPGTAMLSNFALSLFMWNIALRLAGLLLA |
Ga0066667_111265391 | 3300018433 | Grasslands Soil | MAHAAITRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA |
Ga0066662_102634203 | 3300018468 | Grasslands Soil | MAHAATTGLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA |
Ga0066662_104057792 | 3300018468 | Grasslands Soil | MEHVATRRLGKPLPLGTAMLSNIALSLLMWNIALRIAGLLLA |
Ga0210407_102011902 | 3300020579 | Soil | MQHAAITRSHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA |
Ga0210403_100049305 | 3300020580 | Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVVWLLAA |
Ga0210395_102070963 | 3300020582 | Soil | MVHGAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAA |
Ga0210395_107147412 | 3300020582 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIAGLLLAA |
Ga0210401_102230782 | 3300020583 | Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLLAA |
Ga0210401_102594072 | 3300020583 | Soil | MAHTAATRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAA |
Ga0210404_100911123 | 3300021088 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA |
Ga0210400_100124084 | 3300021170 | Soil | MAHAAITRLQEPMPFGTAMLSNIALSLFLWNITFRIAGLLFAA |
Ga0210405_110573651 | 3300021171 | Soil | MANAAMTRLQQPLPLGTAMLSNIALSLLLWNIAFRVAGLLLSG |
Ga0210396_110071211 | 3300021180 | Soil | MTQAATTRLRQPLPLGTAILSHIALSLLLWNLTFRIVGWLLAA |
Ga0213873_100645522 | 3300021358 | Rhizosphere | MAHAATTRVQEPLPLDTALLSNIALSLFLWNIAFRIAGLLLAD |
Ga0213882_100258841 | 3300021362 | Exposed Rock | MEHAVTRRSGEPLPLSTAMLSNVALSLLMWNITLRIVGLLLA |
Ga0213874_102348022 | 3300021377 | Plant Roots | MAHAATTQVQEPLPLDTALLSNIALSLFLWNIAFRIAGLLLAD |
Ga0210389_100687671 | 3300021404 | Soil | GAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAA |
Ga0210389_104665921 | 3300021404 | Soil | RLHEPVPLGTAMLSHIALSLFLWNIALRIAGLLLAA |
Ga0210387_101667503 | 3300021405 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIAG |
Ga0210383_102787523 | 3300021407 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRI |
Ga0210383_105372791 | 3300021407 | Soil | VKRSRPMQHAAITRLHEPVPLGVAMLSHIALSLFLWNITLRIVGLLLAA |
Ga0210383_108999901 | 3300021407 | Soil | RARVKRSRPMQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA |
Ga0210394_109112781 | 3300021420 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIA |
Ga0210384_107270544 | 3300021432 | Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLAFRIV |
Ga0210410_100789011 | 3300021479 | Soil | HAIRIRSKEPLPLGMAMLSNIALSLFMWNLALRIVGLLFAG |
Ga0210410_103210861 | 3300021479 | Soil | MTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFAA |
Ga0210409_107019814 | 3300021559 | Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLAFRIVDW |
Ga0126371_100686366 | 3300021560 | Tropical Forest Soil | MERVATRWLGEPLPLGTAMLCNLALSLLMWNVTLRLALLLAA |
Ga0126371_104457373 | 3300021560 | Tropical Forest Soil | MESVATKWLGEPLPLGTAMLSNFALSLFMWNVALRLAGLLLA |
Ga0126371_105363411 | 3300021560 | Tropical Forest Soil | MEHVVTRRSAEPLPLGTAMLSNFALSLLMWNIALRIAGLLLA |
Ga0126371_111763372 | 3300021560 | Tropical Forest Soil | MEHVATRRVGKSLPLGSAILFNIVLSMWIIVLRIAGLLLPA |
Ga0242644_10430352 | 3300022498 | Soil | MVHGAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLA |
Ga0242660_10292202 | 3300022531 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA |
Ga0242672_10105741 | 3300022720 | Soil | MQHAAITRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLFA |
Ga0242665_100063153 | 3300022724 | Soil | MQHAAMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA |
Ga0242665_101151993 | 3300022724 | Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLAFRIVDWLLAA |
Ga0207692_109317331 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVVARRLDEPLPLSTAMLSNIALSLLMWNIALRIADLLLTA |
Ga0209687_10552583 | 3300026322 | Soil | MAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRSAGLLLAA |
Ga0257149_10067172 | 3300026355 | Soil | MQHAAMTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLILAA |
Ga0209059_10160756 | 3300026527 | Soil | MKHVATRRLAEPLPLGMAMLSNVALSLLMWNITLRIAGLLLA |
Ga0209474_101946113 | 3300026550 | Soil | MAHAATTRLQEPLPPDTAILSTIALSLFLWIIALRIAGLLLAA |
Ga0209648_101431743 | 3300026551 | Grasslands Soil | MAHAATTRLQKPLPLGTAMLSNIALSLFLWNITLRIAGLLFAA |
Ga0209648_103969321 | 3300026551 | Grasslands Soil | MTHAATTRLQKPLPLGTAMLSNIALSLFLWNIAFRIAGLLLAA |
Ga0209577_101435312 | 3300026552 | Soil | MAHAATTRLQEPLPPDTAMLSTIALSLFLWNIALRIAGLLLAA |
Ga0208730_10200741 | 3300027047 | Forest Soil | MTQAATTRLRQPLPLGTAMLSHIALSLLLWNLTFRIVGWLL |
Ga0208859_10049632 | 3300027069 | Forest Soil | MTRLHEPVPLGTAMLSHIALSLFLWNITLRIAGLLLAA |
Ga0208366_10002675 | 3300027073 | Forest Soil | YRAKVKRSRPMQHAAITRLHEPVPLGTAMLSHIALSLFLWNIALRIAGLLLAA |
Ga0209038_100525402 | 3300027737 | Bog Forest Soil | MAHAAITPLQEPLPLGMAMLSNIALSLLMWNIALRIVSLLLAA |
Ga0209655_101588461 | 3300027767 | Bog Forest Soil | MEYAAITRLPEPLPLGTAMLSNIALSLLMWNIALRIASLLLAA |
Ga0209656_102979622 | 3300027812 | Bog Forest Soil | MALAVTTRSEEPLPLGTAMLSNIALSLFMWNIALRIAGLL |
Ga0209040_101251683 | 3300027824 | Bog Forest Soil | MALAVTTRSEEPLPLGTAMLSNIALSLFMWNIALRIAGLLLAA |
Ga0209040_104976762 | 3300027824 | Bog Forest Soil | MAQAATTRLEEPLPLGMAMLSNIALSLFMWNIALRIAGLLLAA |
Ga0170824_1033347912 | 3300031231 | Forest Soil | MAHAAITRLQEPLPLDTAMLSNIALSLLLWNIALRIAGLLLAS |
Ga0170818_1078246682 | 3300031474 | Forest Soil | MKYVATRWLAEPLPLGTALLSNVTLSLLMWNITLRIAGLLLA |
Ga0170818_1145183122 | 3300031474 | Forest Soil | MAQGAMTRSQEPLPLDTAMLSNIALSLFLWNVTLRIATLLLAA |
Ga0318516_101361622 | 3300031543 | Soil | MESVATKWLGEPLPPGTAMLSNFALSLFMWNVALRLAGLLLA |
Ga0318573_102224391 | 3300031564 | Soil | MESVATKWLGEPLPPGTAMLSNFALSLFMWNVALRVAGLLLA |
Ga0318561_103311821 | 3300031679 | Soil | KWLGEPLPPGTAMLSNFALSLFMWNVALRLAGLLLA |
Ga0318561_107622722 | 3300031679 | Soil | MAQAAITRLQEPLPLDTAMLSNIALSLFLWNIALRIAGLLLAP |
Ga0306921_111133471 | 3300031912 | Soil | MPHAAGTRSEEPLPLGTAILSNIALSLVMWNVALR |
Ga0318531_102599781 | 3300031981 | Soil | MESVATKWLGEPLPLGTAMLSNFALSLFIWNVALRLAGLLLA |
Ga0306922_115978381 | 3300032001 | Soil | MAQAAITRLQEPLPLDTAMLSNIALSLFLWNIALRIGGLLLAP |
Ga0306920_1040494652 | 3300032261 | Soil | MEHVVTRRSAEPLPLGTAMLSNFALSLLMWNIALRVAGLLLA |
⦗Top⦘ |