| Basic Information | |
|---|---|
| Family ID | F090703 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.85 % |
| % of genes near scaffold ends (potentially truncated) | 98.15 % |
| % of genes from short scaffolds (< 2000 bps) | 87.96 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.148 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.593 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.148 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.481 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF02625 | XdhC_CoxI | 61.11 |
| PF13478 | XdhC_C | 21.30 |
| PF00196 | GerE | 4.63 |
| PF04672 | Methyltransf_19 | 2.78 |
| PF01522 | Polysacc_deac_1 | 1.85 |
| PF12804 | NTP_transf_3 | 0.93 |
| PF07179 | SseB | 0.93 |
| PF00218 | IGPS | 0.93 |
| PF11392 | DUF2877 | 0.93 |
| PF01264 | Chorismate_synt | 0.93 |
| PF13401 | AAA_22 | 0.93 |
| PF13581 | HATPase_c_2 | 0.93 |
| PF01810 | LysE | 0.93 |
| PF01263 | Aldose_epim | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 61.11 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.85 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.93 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.93 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.15 % |
| Unclassified | root | N/A | 26.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10448025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300005332|Ga0066388_108783661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300005363|Ga0008090_15827410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300005764|Ga0066903_106900458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300005921|Ga0070766_11153447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300005921|Ga0070766_11317973 | Not Available | 500 | Open in IMG/M |
| 3300006028|Ga0070717_10050068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3431 | Open in IMG/M |
| 3300006057|Ga0075026_100424805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300006175|Ga0070712_100646252 | Not Available | 898 | Open in IMG/M |
| 3300006176|Ga0070765_102244201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300006797|Ga0066659_10812575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300006903|Ga0075426_11240897 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006914|Ga0075436_101042711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300009628|Ga0116125_1094032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 796 | Open in IMG/M |
| 3300009683|Ga0116224_10209090 | Not Available | 934 | Open in IMG/M |
| 3300009764|Ga0116134_1074584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1255 | Open in IMG/M |
| 3300010048|Ga0126373_12876155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300010322|Ga0134084_10352435 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010326|Ga0134065_10105795 | Not Available | 940 | Open in IMG/M |
| 3300010358|Ga0126370_10627111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
| 3300010359|Ga0126376_11543579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300010856|Ga0126358_1247073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1352 | Open in IMG/M |
| 3300010867|Ga0126347_1229187 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010876|Ga0126361_10933932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300011075|Ga0138555_1155288 | Not Available | 565 | Open in IMG/M |
| 3300011077|Ga0138572_1049167 | Not Available | 848 | Open in IMG/M |
| 3300011120|Ga0150983_10579010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300011120|Ga0150983_10973957 | Not Available | 500 | Open in IMG/M |
| 3300011120|Ga0150983_12663447 | Not Available | 995 | Open in IMG/M |
| 3300011120|Ga0150983_13766054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300012349|Ga0137387_10203870 | Not Available | 1421 | Open in IMG/M |
| 3300012362|Ga0137361_11636199 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012390|Ga0134054_1183573 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012403|Ga0134049_1014844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1094 | Open in IMG/M |
| 3300012481|Ga0157320_1000540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
| 3300012944|Ga0137410_10141297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. | 1825 | Open in IMG/M |
| 3300012987|Ga0164307_11793324 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300015372|Ga0132256_102440549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300016422|Ga0182039_10730813 | Not Available | 875 | Open in IMG/M |
| 3300017924|Ga0187820_1035485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1308 | Open in IMG/M |
| 3300017937|Ga0187809_10312602 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017942|Ga0187808_10132443 | Not Available | 1094 | Open in IMG/M |
| 3300017955|Ga0187817_10079095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2054 | Open in IMG/M |
| 3300017972|Ga0187781_10562198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300018007|Ga0187805_10213456 | Not Available | 882 | Open in IMG/M |
| 3300018033|Ga0187867_10742972 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018035|Ga0187875_10347544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300018037|Ga0187883_10585916 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300018058|Ga0187766_10018794 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
| 3300018058|Ga0187766_10346381 | Not Available | 972 | Open in IMG/M |
| 3300018086|Ga0187769_11061055 | Not Available | 613 | Open in IMG/M |
| 3300019883|Ga0193725_1036291 | Not Available | 1300 | Open in IMG/M |
| 3300020581|Ga0210399_10786992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
| 3300020581|Ga0210399_11369748 | Not Available | 554 | Open in IMG/M |
| 3300021377|Ga0213874_10407570 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021405|Ga0210387_11223102 | Not Available | 652 | Open in IMG/M |
| 3300021474|Ga0210390_10079527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2716 | Open in IMG/M |
| 3300021477|Ga0210398_10571193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 919 | Open in IMG/M |
| 3300022499|Ga0242641_1018329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300022716|Ga0242673_1134219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300022718|Ga0242675_1052714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300022733|Ga0224562_1013708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300024275|Ga0247674_1044755 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025917|Ga0207660_10716532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
| 3300026294|Ga0209839_10024759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2322 | Open in IMG/M |
| 3300026377|Ga0257171_1049161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300027047|Ga0208730_1018837 | Not Available | 775 | Open in IMG/M |
| 3300027370|Ga0209010_1084681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300027545|Ga0209008_1048588 | Not Available | 969 | Open in IMG/M |
| 3300027680|Ga0207826_1053859 | Not Available | 1113 | Open in IMG/M |
| 3300027846|Ga0209180_10136095 | Not Available | 1412 | Open in IMG/M |
| 3300027869|Ga0209579_10416024 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027889|Ga0209380_10747841 | Not Available | 558 | Open in IMG/M |
| 3300028742|Ga0302220_10195074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300028798|Ga0302222_10376005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300028806|Ga0302221_10271306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
| 3300028877|Ga0302235_10004109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 10037 | Open in IMG/M |
| 3300028877|Ga0302235_10004551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 9479 | Open in IMG/M |
| 3300028880|Ga0307300_10250099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300029943|Ga0311340_10023769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 7611 | Open in IMG/M |
| 3300029943|Ga0311340_10372464 | Not Available | 1324 | Open in IMG/M |
| 3300029999|Ga0311339_10022036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 9419 | Open in IMG/M |
| 3300030007|Ga0311338_10420505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1428 | Open in IMG/M |
| 3300030007|Ga0311338_10482330 | Not Available | 1305 | Open in IMG/M |
| 3300030490|Ga0302184_10301251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300030520|Ga0311372_10267540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2745 | Open in IMG/M |
| 3300030520|Ga0311372_12183322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300030580|Ga0311355_11170639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300030617|Ga0311356_10162857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2301 | Open in IMG/M |
| 3300030738|Ga0265462_10157756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1159 | Open in IMG/M |
| 3300031027|Ga0302308_10453399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300031234|Ga0302325_11854253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300031572|Ga0318515_10738927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031751|Ga0318494_10385523 | Not Available | 812 | Open in IMG/M |
| 3300031751|Ga0318494_10582728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300031912|Ga0306921_10147233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2754 | Open in IMG/M |
| 3300032001|Ga0306922_10608407 | Not Available | 1157 | Open in IMG/M |
| 3300032010|Ga0318569_10194496 | Not Available | 939 | Open in IMG/M |
| 3300032039|Ga0318559_10481938 | Not Available | 579 | Open in IMG/M |
| 3300032054|Ga0318570_10094082 | Not Available | 1302 | Open in IMG/M |
| 3300032066|Ga0318514_10717873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300032261|Ga0306920_100961819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1246 | Open in IMG/M |
| 3300032515|Ga0348332_12498253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300032896|Ga0335075_10817535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300032954|Ga0335083_11124274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300032955|Ga0335076_10532648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1057 | Open in IMG/M |
| 3300033289|Ga0310914_10034588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4061 | Open in IMG/M |
| 3300034124|Ga0370483_0313707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 15.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_104480251 | 3300003505 | Forest Soil | WERATTDKYGWLSAEDLEADERPAHPDIPDLIRQAVASVRA* |
| Ga0066388_1087836612 | 3300005332 | Tropical Forest Soil | ERATTDKYGWLTAEDFEDGERPAHPDIPDLIRVAAARAGNRHRRE* |
| Ga0008090_158274102 | 3300005363 | Tropical Rainforest Soil | ATTDKYGWLAAADLGADERPAHPDIPDLIRAAVASVRRE* |
| Ga0066903_1069004582 | 3300005764 | Tropical Forest Soil | LWERATTDKYGWLTAEDLEAGEHPAHPELPDLIRAAVASVRRG* |
| Ga0070766_111534472 | 3300005921 | Soil | WERATTDKYGWLSAEDLGGDERPADPAIPDLMRAAAASVRDPRP* |
| Ga0070766_113179731 | 3300005921 | Soil | YGWLSADDLGPDMPPADPSLPGLIRAAAVSVRDRRSSGS* |
| Ga0070717_100500684 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAWERATTDKYGWLTAEDLGGDERPADPDLPRLIRAAVASARNRRSRE* |
| Ga0075026_1004248051 | 3300006057 | Watersheds | DKFGWLAVGDLSAGDPPAHPDIPDLIRAAAASVRHR* |
| Ga0070712_1006462522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ATTDKYGWLTAEDLETDERPADVGIPDIIRAAVASVGRDQAGE* |
| Ga0070765_1022442011 | 3300006176 | Soil | TTDKYGWLSAEDLEADERPADPEIPDLIRKAVASVRAG* |
| Ga0066659_108125751 | 3300006797 | Soil | DQWERATTDKYGWVTADDLGADEHPAHPDIPDLMRAAAAAVGNQELR* |
| Ga0075426_112408972 | 3300006903 | Populus Rhizosphere | LDQWERATTDKYGWLTADDLGADERPAHPDIPDLMRAAAAAVRPRE* |
| Ga0075436_1010427112 | 3300006914 | Populus Rhizosphere | KYGWLTAEDLEAGERPAHPDIPDLIRAAVASVRREQAGE* |
| Ga0116125_10940322 | 3300009628 | Peatland | YGWLSAEDLETDERPADPEIPDLIRKAVASVRAG* |
| Ga0116224_102090902 | 3300009683 | Peatlands Soil | WERATTDTYGWLTADELGPDKPPADPGLPDLMRAAAASLRDR* |
| Ga0116134_10745841 | 3300009764 | Peatland | YGWLTPADLEADERPAHPDIPDLIRTAAASVRHR* |
| Ga0126373_128761551 | 3300010048 | Tropical Forest Soil | TTDKYGWLSAGDLGPEMPPADPSLPGLIRAAAASVRDRQPWRL* |
| Ga0134084_103524351 | 3300010322 | Grasslands Soil | DKYGWLTAEDLEAGERPAHPGIPDLIRAAVASVRREQAGE* |
| Ga0134065_101057951 | 3300010326 | Grasslands Soil | TTDKYGWLTAEDLETGERPAHPDIPDLIRAAVASVRREQAGE* |
| Ga0126370_106271112 | 3300010358 | Tropical Forest Soil | ERATTDKYGWLTAEDLEAGEHPAHSELPDLIRAAVASVRRE* |
| Ga0126376_115435792 | 3300010359 | Tropical Forest Soil | LDHWERATTDKYGWLTAEDLETDERPADAGIPDLIRAAVASVRRV* |
| Ga0126358_12470732 | 3300010856 | Boreal Forest Soil | WERATTDKYGWLTAEDLEDGERPAHPDIPDLVRVAAASVRRE* |
| Ga0126347_12291872 | 3300010867 | Boreal Forest Soil | DKYGWLAAAELEDGERPAHPDIPDLIRAAAASVLGE* |
| Ga0126361_109339322 | 3300010876 | Boreal Forest Soil | ERATTDKYGWLSADDLGPDMPPADPSLPGLIRAAAASVRDRT* |
| Ga0138555_11552882 | 3300011075 | Peatlands Soil | DWERATTDTYGWLTADDLAPDKPPADPGLPDLIRAAAASVRGRRRE* |
| Ga0138572_10491671 | 3300011077 | Peatlands Soil | TDTYGWLTADDLGPDKPPADPGLPDLIRAAAASVRGRRRE* |
| Ga0150983_105790101 | 3300011120 | Forest Soil | RATTDKYGWLSAEDLEADERPADPEIPDLIRKAVASVRAG* |
| Ga0150983_109739571 | 3300011120 | Forest Soil | WERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRA* |
| Ga0150983_126634471 | 3300011120 | Forest Soil | TDKYGWLTADDLGADERPAHPEIPDLMRAAAAAVGIRS* |
| Ga0150983_137660541 | 3300011120 | Forest Soil | TTDRYGWLSAEDLEADETPGHPEIPGLIRAAVASVRSRRP* |
| Ga0137387_102038701 | 3300012349 | Vadose Zone Soil | EQATTDKYGWLAATDFDADERPAHPDIPELMRAAAAAVRVRS* |
| Ga0137361_116361991 | 3300012362 | Vadose Zone Soil | KYGWIAAGDLGADERPAHPDIPDLIRAAAASVRR* |
| Ga0134054_11835732 | 3300012390 | Grasslands Soil | YGWLTAEDLGTDERPAHPDIPDLMRAAVASVRREQAGE* |
| Ga0134049_10148441 | 3300012403 | Grasslands Soil | PTDKYGWLTAEDLEAGERPAHPDIPELIRAAVASARNRHSREQPRE* |
| Ga0157320_10005403 | 3300012481 | Arabidopsis Rhizosphere | TDKYGWLTAEDLETDERPADVGIPDVIRAAVASVGRV* |
| Ga0137410_101412973 | 3300012944 | Vadose Zone Soil | ERATTDKYGWLTADDLGVDERPAHPDIPDLMRAAAAAVGIRS* |
| Ga0164307_117933242 | 3300012987 | Soil | ATTDKYGWLTAEDLGADERPAHPDIPDLMRAAAAAVRPRE* |
| Ga0132256_1024405491 | 3300015372 | Arabidopsis Rhizosphere | TDKYGWLTAEDLEAGERPAHPDIPNLIRAAVASVRREQAGE* |
| Ga0182039_107308132 | 3300016422 | Soil | DAYEWLSADDLGPDKPPADPSLPDLIRAAVASVRGRPR |
| Ga0187820_10354851 | 3300017924 | Freshwater Sediment | AYGWLSADDLGPDKPPADPGLPDLIRAAVASVRGRPR |
| Ga0187809_103126021 | 3300017937 | Freshwater Sediment | QWERATTDTYGWLTADELGPDKPPADPSLPDLIRAAVASIRDRQP |
| Ga0187808_101324431 | 3300017942 | Freshwater Sediment | GWLSADDLGPDKPPADPSLPDLIRAAVASIRDRQP |
| Ga0187817_100790953 | 3300017955 | Freshwater Sediment | GLDQWERATTDKYGWLTAADLEADERPAHPDIPDLIRAAAASVRYR |
| Ga0187781_105621982 | 3300017972 | Tropical Peatland | EQATTDKYGWLAAGDLGADERPAHPDIPDLIRAAAASVRRE |
| Ga0187805_102134562 | 3300018007 | Freshwater Sediment | ERATTDKYGWLSADDLGPDQRPADPSLPDLIRAAAASVRDRGPERS |
| Ga0187867_107429722 | 3300018033 | Peatland | KYGWLSAEDLEADERSAHPDIPDLIRKAVVSVRAE |
| Ga0187875_103475442 | 3300018035 | Peatland | ATTDKYGWLAAGELDGDERPAHPDIPDLMRVAAARVLGK |
| Ga0187883_105859161 | 3300018037 | Peatland | TTDKYGWLTPADLEADERPAHPDIPDLIRTAAASVRHR |
| Ga0187766_100187943 | 3300018058 | Tropical Peatland | DKYGWLSADDLGADEPPAHPDIPDLIRAAVASAGISPR |
| Ga0187766_103463811 | 3300018058 | Tropical Peatland | DAYGWLSADDLGPDQPPADPGLPDLIRAAVAIVRDRPR |
| Ga0187769_110610552 | 3300018086 | Tropical Peatland | DSWERATTDKYAWFSAEDLESGEPLADPDLPDLARSAVAAVRARPR |
| Ga0193725_10362912 | 3300019883 | Soil | KYGWLTAEDLEAGERPAHPDIPDLIRAAVAIVRRDQAGE |
| Ga0210399_107869921 | 3300020581 | Soil | DKYAWLSADDLGPDMPPADPSLPGLIRAAAVSVRDRT |
| Ga0210399_113697482 | 3300020581 | Soil | SWERATTDKYGWLSADDLGPDMPPADPALPDLIRAAAASVRGGA |
| Ga0213874_104075701 | 3300021377 | Plant Roots | EQATTDKYGWLAAEDLGADERPAHPDIPDLIRAAAASVRRE |
| Ga0210387_112231021 | 3300021405 | Soil | ASTDKYAWLSAEDFGPDERPADPDIPDLIRAAAAAVQARPR |
| Ga0210390_100795275 | 3300021474 | Soil | DAYGWLSADDLGPDKPPADPSLPDLIRAAVASIRDRQP |
| Ga0210398_105711932 | 3300021477 | Soil | TTDKFGWLAVGDLSADDPPAHPDIPDLIRAAAASVRHR |
| Ga0242641_10183291 | 3300022499 | Soil | RATTDRYGWLSADDLGPDMPPADPSLPGLIRAAAVSVRNRT |
| Ga0242673_11342191 | 3300022716 | Soil | LDQWERATTDRYGWLFAEDLEAGERPAHPDILDLIRKAVASVRAD |
| Ga0242675_10527141 | 3300022718 | Soil | DKYGWLSADDLGPDMPPADPSLPGLIRAAAVSVHGRT |
| Ga0224562_10137082 | 3300022733 | Soil | DKFGWLAVADLSADDPPAHPDIPDLIRAAAASVRHR |
| Ga0247674_10447551 | 3300024275 | Soil | DKYAWLTAEDLETDERPADVGIPDIIRAAVASVGRA |
| Ga0207660_107165321 | 3300025917 | Corn Rhizosphere | WERATTDKYAWLTAEDLETDERPADVGIPDIIRAAVASVGRA |
| Ga0209839_100247591 | 3300026294 | Soil | ERATTDKYGWLSADELADGERSAHPDIPDLIRMAVLTVRNRPA |
| Ga0257171_10491611 | 3300026377 | Soil | TTDKYGWLTAEDLEAGERPAHPDIPDLIRAAVASVRREQPRE |
| Ga0208730_10188371 | 3300027047 | Forest Soil | RATTDAYGWLSADDLGPDMPPADPSLPGLIRAAVASVRGE |
| Ga0209010_10846811 | 3300027370 | Forest Soil | TDTYGWLSADDLGPDHPPAEPGLPDLIRAAAASVCGRPGE |
| Ga0209008_10485882 | 3300027545 | Forest Soil | DSWERATTDTYGWLSADDLGPDHPPADPGLPDLIRAAAASVRARRGE |
| Ga0207826_10538591 | 3300027680 | Tropical Forest Soil | DAYGWLLADDLGPDKPPADPGLPDLIRAAVASVRDRRR |
| Ga0209180_101360952 | 3300027846 | Vadose Zone Soil | TTDKYGWLAAEDLEADERPAHPDIPELIRAAAASVREG |
| Ga0209579_104160241 | 3300027869 | Surface Soil | MDSWERATTDKYGWLSADDLGPDMPPADPSLPGLIRAAAASVRDRT |
| Ga0209380_107478412 | 3300027889 | Soil | SWERATTDKYGWLSADDLGPDMPPADPSLPDLIRAAAVSVRGRT |
| Ga0302220_101950741 | 3300028742 | Palsa | TDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE |
| Ga0302222_103760051 | 3300028798 | Palsa | QWEQATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE |
| Ga0302221_102713062 | 3300028806 | Palsa | DDWERATTDKYGWLSAEDLGGDERPADPAIPDLMRAAAASVLDRRP |
| Ga0302235_1000410912 | 3300028877 | Palsa | EGLDQWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE |
| Ga0302235_1000455111 | 3300028877 | Palsa | DKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG |
| Ga0307300_102500992 | 3300028880 | Soil | KYGWLTAEDLETDERPADVGIPDIIRAAVASVGRDQAGE |
| Ga0311340_100237691 | 3300029943 | Palsa | QWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE |
| Ga0311340_103724641 | 3300029943 | Palsa | RATTDKYGWFCAADLENDEPPAHPDIPDLIRLAVASVLGRPA |
| Ga0311339_1002203611 | 3300029999 | Palsa | QWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG |
| Ga0311338_104205051 | 3300030007 | Palsa | LDQWERATTDKYGWFCAADLENDEPPAHPDIPDLIRLAVASVLGRPA |
| Ga0311338_104823302 | 3300030007 | Palsa | GWFCAADLENDEPPAHPDIPDLIRLAVASVLGRPA |
| Ga0302184_103012512 | 3300030490 | Palsa | RATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAE |
| Ga0311372_102675401 | 3300030520 | Palsa | ERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG |
| Ga0311372_121833221 | 3300030520 | Palsa | RATTDKYGWLSAEDLEAGERPADPEIPDLIRKAVASVRAG |
| Ga0311355_111706392 | 3300030580 | Palsa | ERATTDKYGWLSAEDLEAGERPADPEIPDLIRKAVASVRAG |
| Ga0311356_101628571 | 3300030617 | Palsa | TTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG |
| Ga0265462_101577561 | 3300030738 | Soil | DEWEKATTDRYGWLSAEDLEADETPGHPELPGLIRAAVASVRSRRP |
| Ga0302308_104533991 | 3300031027 | Palsa | WERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG |
| Ga0302325_118542531 | 3300031234 | Palsa | EGLDQWERATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRAG |
| Ga0318515_107389271 | 3300031572 | Soil | TTDKYGWLSAEDLEGGEPPADPEIPDLIRAAAASVRRE |
| Ga0318494_103855231 | 3300031751 | Soil | TDRYGWLSPDDLGPDDPPADPEIPDLIRAAAASVRGRQPWRL |
| Ga0318494_105827281 | 3300031751 | Soil | ATTDRYGWLSPDDLGPDDPPADPEIPDLIRAAAASVRGRQPWRL |
| Ga0306921_101472334 | 3300031912 | Soil | EWERATTDAYGWLSADDLGPDKPPADPSLPDLIRAAVASVRGRPR |
| Ga0306922_106084072 | 3300032001 | Soil | WERATTDAYGWLSAEDLGPEKPPADPGLPDLIRAAVASVRDRLR |
| Ga0318569_101944961 | 3300032010 | Soil | LSPDDLGPDDPPADPEIPDLIRAAAASVRGRQPWRL |
| Ga0318559_104819382 | 3300032039 | Soil | WERATTDTYGWLSADDLGPGMPPADPSLPGLIRAAAASVRDRPPWRP |
| Ga0318570_100940821 | 3300032054 | Soil | WERATTDAYGWLSADDLGPDKPPADPSLPDLIRAAVASVRGRPR |
| Ga0318514_107178731 | 3300032066 | Soil | DKYGWLTAEDLETTERPADSGIPDIIRAAVASVRRE |
| Ga0306920_1009618192 | 3300032261 | Soil | DRYGWLSPDDLGPDDPPADPEIPDLIRAAAASVRDRQPWRS |
| Ga0348332_124982532 | 3300032515 | Plant Litter | ATTDKYGWLSAEDLEADERPAHPDIPDLIRKAVASVRA |
| Ga0335075_108175351 | 3300032896 | Soil | QWEQATTDTYGWLAAGDLEGDERPAHPDIPDLMRVAEARVLGN |
| Ga0335083_111242742 | 3300032954 | Soil | ATTDKYGWLTAGDLEAGERPAHPDIPDLIRAAVASVRREQAGE |
| Ga0335076_105326481 | 3300032955 | Soil | RATTDKYGWLTAEDLEADGHPADSGIPDLIRAAVVSVRRE |
| Ga0310914_100345881 | 3300033289 | Soil | DGLDLWERATTDKYGWLTAEDLEAGEHPAHSELPDLIRAAVASVRRG |
| Ga0370483_0313707_429_542 | 3300034124 | Untreated Peat Soil | KYGWFSAADLENGEPPAHPDIPDLIRLAVATVRSQPG |
| ⦗Top⦘ |