| Basic Information | |
|---|---|
| Family ID | F090697 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VTIRRATEADEALLRELWEEFEREVPEPIGEPETWEQEW |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.59 % |
| % of genes from short scaffolds (< 2000 bps) | 87.96 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.926 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.296 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00730 | HhH-GPD | 86.11 |
| PF04209 | HgmA_C | 3.70 |
| PF12710 | HAD | 2.78 |
| PF07676 | PD40 | 2.78 |
| PF01557 | FAA_hydrolase | 0.93 |
| PF01545 | Cation_efflux | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 86.11 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 86.11 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 86.11 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 86.11 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 86.11 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.70 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.93 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.93 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.93 % |
| Unclassified | root | N/A | 24.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002FH7X9 | Not Available | 519 | Open in IMG/M |
| 3300000886|AL3A1W_1323840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300002568|C688J35102_120472392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1097 | Open in IMG/M |
| 3300004006|Ga0055453_10050747 | Not Available | 1133 | Open in IMG/M |
| 3300004091|Ga0062387_100427735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
| 3300004092|Ga0062389_100087451 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
| 3300004114|Ga0062593_102165499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300004479|Ga0062595_102103302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300005167|Ga0066672_10646724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300005175|Ga0066673_10612274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300005175|Ga0066673_10894047 | Not Available | 505 | Open in IMG/M |
| 3300005176|Ga0066679_11011431 | Not Available | 517 | Open in IMG/M |
| 3300005363|Ga0008090_15530405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300005364|Ga0070673_101109620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 3300005518|Ga0070699_101549093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300005530|Ga0070679_100599267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1045 | Open in IMG/M |
| 3300005544|Ga0070686_101034424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300005561|Ga0066699_11186839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300005563|Ga0068855_100252112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1968 | Open in IMG/M |
| 3300005578|Ga0068854_101587196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300006028|Ga0070717_11646304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300006031|Ga0066651_10528710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300006032|Ga0066696_10784505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300006046|Ga0066652_100286157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1458 | Open in IMG/M |
| 3300006046|Ga0066652_101822751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300006175|Ga0070712_100940650 | Not Available | 746 | Open in IMG/M |
| 3300006903|Ga0075426_10716035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300006904|Ga0075424_102762326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300009093|Ga0105240_10323670 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300009093|Ga0105240_12450191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300009093|Ga0105240_12688179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300009098|Ga0105245_11861692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300009137|Ga0066709_100496681 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300009137|Ga0066709_104519168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300009181|Ga0114969_10572341 | Not Available | 622 | Open in IMG/M |
| 3300009840|Ga0126313_10087673 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300010037|Ga0126304_10132674 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300010042|Ga0126314_10799369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300010322|Ga0134084_10305557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300010373|Ga0134128_12067056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300010373|Ga0134128_12703699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300010379|Ga0136449_100607958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1861 | Open in IMG/M |
| 3300010399|Ga0134127_13162585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300010880|Ga0126350_10338486 | Not Available | 549 | Open in IMG/M |
| 3300010885|Ga0133913_12774484 | Not Available | 1181 | Open in IMG/M |
| 3300011994|Ga0120157_1008121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2890 | Open in IMG/M |
| 3300012005|Ga0120161_1129929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300012211|Ga0137377_11839822 | Not Available | 524 | Open in IMG/M |
| 3300012498|Ga0157345_1051783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300012911|Ga0157301_10012510 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300012960|Ga0164301_10476680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
| 3300012976|Ga0134076_10235384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300012986|Ga0164304_11282035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300013104|Ga0157370_10293268 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300015358|Ga0134089_10181656 | Not Available | 840 | Open in IMG/M |
| 3300015372|Ga0132256_103473427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300017947|Ga0187785_10499154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300018061|Ga0184619_10275570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
| 3300018482|Ga0066669_12144171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300019878|Ga0193715_1092392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300019890|Ga0193728_1048494 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
| 3300020006|Ga0193735_1113678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300025914|Ga0207671_10801398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300025916|Ga0207663_11232678 | Not Available | 602 | Open in IMG/M |
| 3300025917|Ga0207660_11006106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300025920|Ga0207649_10517027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300025921|Ga0207652_10186985 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300025921|Ga0207652_11439458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300025922|Ga0207646_10538859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1050 | Open in IMG/M |
| 3300025928|Ga0207700_11961126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300025939|Ga0207665_10481114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 957 | Open in IMG/M |
| 3300025944|Ga0207661_11291113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300025949|Ga0207667_10240178 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300026067|Ga0207678_10640090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
| 3300026067|Ga0207678_11176625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300026067|Ga0207678_11424866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300026078|Ga0207702_10526408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1154 | Open in IMG/M |
| 3300026316|Ga0209155_1274015 | Not Available | 523 | Open in IMG/M |
| 3300026538|Ga0209056_10500305 | Not Available | 638 | Open in IMG/M |
| 3300026550|Ga0209474_10439372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300027773|Ga0209810_1188943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
| 3300027909|Ga0209382_11391171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300028755|Ga0307316_10308217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300028784|Ga0307282_10446680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300028809|Ga0247824_11008898 | Not Available | 527 | Open in IMG/M |
| 3300028828|Ga0307312_10313516 | Not Available | 1023 | Open in IMG/M |
| 3300028881|Ga0307277_10520817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300028885|Ga0307304_10441513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300029957|Ga0265324_10014300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2941 | Open in IMG/M |
| 3300031672|Ga0307373_10199262 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300031713|Ga0318496_10195589 | Not Available | 1111 | Open in IMG/M |
| 3300031719|Ga0306917_11262274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300031938|Ga0308175_102109542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300031938|Ga0308175_102177972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300031996|Ga0308176_11732430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300032068|Ga0318553_10100321 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300032090|Ga0318518_10049722 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300032892|Ga0335081_12665476 | Not Available | 511 | Open in IMG/M |
| 3300032955|Ga0335076_10629489 | Not Available | 955 | Open in IMG/M |
| 3300033004|Ga0335084_10289192 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_11205730 | 2170459003 | Grass Soil | VNIRRATEADEATLRELWEEFNVEVPEPVGESETWAE |
| AL3A1W_13238402 | 3300000886 | Permafrost | MADEAIAIRPAKEADEAILRELWEEFEREVPEPAGFEPETWEDEWRD |
| C688J35102_1204723923 | 3300002568 | Soil | VTIRRATEADEAVLRELWEEFEQEIPYPLGESEPWEEEWPDTLDDIRGGGVF |
| Ga0055453_100507473 | 3300004006 | Natural And Restored Wetlands | VRIRRATEADQAVLRELWEEFEAEVPDPFGQEPWEDEWADTRRD |
| Ga0062387_1004277351 | 3300004091 | Bog Forest Soil | VKIRRVTEADEAEIRKLWEEFEAEVPEPPGTAPETWEEEWA |
| Ga0062389_1000874511 | 3300004092 | Bog Forest Soil | VKIRRVTEADEAEIRKLWEEFEAEVPEPPGTAPETWEEEWADAQVALA |
| Ga0062593_1012566751 | 3300004114 | Soil | MTINIRLATEADQAALRELWEEFETEIPAPPEFVEPWAEEWR |
| Ga0062593_1021654991 | 3300004114 | Soil | MNIRHATTADEAMLRELWEEFEREVPEPPGATPETWEEEWADVHRDIVEG |
| Ga0062595_1021033021 | 3300004479 | Soil | VNIRRATEADEAELRRLWEDFSIEVPEPPGFPPEEWDEQWGVIRRNLDG |
| Ga0062595_1021750732 | 3300004479 | Soil | MRIRAAGEADEQVLRELWEEFETEIPAPPEWVETWEEEWVDV |
| Ga0062592_1015734562 | 3300004480 | Soil | MNLRAATKADEPVLRELWEEFEAELPAPPEDVETWEQEWQD |
| Ga0066672_106467242 | 3300005167 | Soil | VTIRRATEADEGVLRELWEEFEREVPEPFGEGEPWEGEWADTLDDIR |
| Ga0066673_106122741 | 3300005175 | Soil | MSVRAATEADQEVLRELWTEFEREVPEPYGEGEPWEAEWADTLDDIRGG |
| Ga0066673_108940471 | 3300005175 | Soil | MRIRAATEADGPVLLELWTEFEAEVPEPEGWAPETWDEAWAAFRKHI |
| Ga0066679_110114312 | 3300005176 | Soil | VTIRRATEADEGVLRELWEEFERELPEPFGEGEPWEDEWADTLDDIRGGGVFLA |
| Ga0008090_155304051 | 3300005363 | Tropical Rainforest Soil | VNIRPATAADEQALRELWEEFEREVPEPAGWRPATWGDEWSGLQKG |
| Ga0070673_1011096202 | 3300005364 | Switchgrass Rhizosphere | VTIRRATESDEAVLRELWEEFEREVPEPIGEGEPWEEEWSDTLDDIRGGGVF |
| Ga0070678_1006744901 | 3300005456 | Miscanthus Rhizosphere | MNIRPATEADQAALRELWEEFEAEIPAPPEFVETWEQEWQDVSADI |
| Ga0070699_1015490932 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVRRATLADEAVLKQLWEEFEREVPEPPGATGETWEEEWTDV |
| Ga0070679_1005992672 | 3300005530 | Corn Rhizosphere | VNIRRATEADEAELRRLWEDFSIEVPEPPGFPPEEWDEQWGVI |
| Ga0070731_105522512 | 3300005538 | Surface Soil | MTVRRATEADEPTLREFWAEFEAEVPYPFAEERETWE |
| Ga0070686_1010344242 | 3300005544 | Switchgrass Rhizosphere | VTIRRATESDEAVLRELWEEFEQEVPWPFGEGETWEEEWADTLDDIRGG |
| Ga0066699_111868391 | 3300005561 | Soil | VTIRRATEADEGVLRELWEEFERELPEPFGEGEPWEDEWADTL |
| Ga0068855_1002521124 | 3300005563 | Corn Rhizosphere | MADAPLTIRRATEADEQVLRDLWEEFEREVPWEIEEPETWADEWPDTLDDLRGGGVFVAE |
| Ga0068854_1015871961 | 3300005578 | Corn Rhizosphere | MADEALTIRAATEADEAVLRELWEEFEQEVPWELEEPETWADEWRDTLDDIRTG |
| Ga0070717_116463042 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVRAATAADETALHELWAEFEAEVPEPDGYTPDTWEEAWADLRGGIDAGAVFL |
| Ga0066651_105287102 | 3300006031 | Soil | VRIRRATEADEPVLRELWEEFEAEVPEPPGYAPETWDEA |
| Ga0066696_107845052 | 3300006032 | Soil | VTIRRATEADEAVLRELWEEFEREVPWELEDPETWADEWKDTQ |
| Ga0066652_1002861573 | 3300006046 | Soil | VTIRRATEADEAVLRELWEEFEQEIPYPLGESEPWEEEWPDTLDDIRGGG |
| Ga0066652_1018227511 | 3300006046 | Soil | VRIRRATEADGAALRELWEEFEREVPEPEGFEHETW |
| Ga0070712_1009406502 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MADAVTIRRATEADEAVLRALWEEFEAEIPWELEEPEAWADEWPDTLDDIKG |
| Ga0075426_107160352 | 3300006903 | Populus Rhizosphere | VNVRRATEGDQEVLRDLWTEFEREVPEPYGEGEPWEAEWAD |
| Ga0075424_1027623261 | 3300006904 | Populus Rhizosphere | MNIRPATEADQAALRELWEEFEAEIPSPPEFVETWEQEWQD |
| Ga0066710_1001501131 | 3300009012 | Grasslands Soil | VNLRRATEADEPVLRELWEEFEAEIPSPPEFVETWEEEW |
| Ga0105240_103236701 | 3300009093 | Corn Rhizosphere | VTIRRATEADEAILRELWEEFESEVPEPVGEPETWEQEW |
| Ga0105240_124501912 | 3300009093 | Corn Rhizosphere | MADAPLTIRRATEADEQVLRDLWEEFEREVPWEIEEPETWADEWPD |
| Ga0105240_126881791 | 3300009093 | Corn Rhizosphere | VTIRRATEADEAILRELWEEFEREVPWDIEAPETW |
| Ga0105245_118616922 | 3300009098 | Miscanthus Rhizosphere | VTIRRATEADEAILRELWEEFEREVPWDIEDPEAWADEWPDTLD |
| Ga0066709_1004966811 | 3300009137 | Grasslands Soil | VIRRATVVDEPVLRELWEDFEAEIPEPEGFEPETWDEEWVDVRRDIEDGIVCL |
| Ga0066709_1045191682 | 3300009137 | Grasslands Soil | VRIRRATEADEPVLRELWEEFEAEVPEPPGFTAESWDEAWADVRRHIAEG |
| Ga0075423_110139871 | 3300009162 | Populus Rhizosphere | MTVRHATEADQQALRELWEEFEAEVPAPPEFVETWDEEWQDVAAD |
| Ga0114969_105723411 | 3300009181 | Freshwater Lake | VNIRQATVADEAALRELTAEYEAEVPEPPGYEPDHWAE |
| Ga0126313_100876731 | 3300009840 | Serpentine Soil | MTIRRATEADQAALRELWEDFEREVPEPPGFTPERW |
| Ga0126304_101326743 | 3300010037 | Serpentine Soil | MTIRRATEADEAALRELWEEFEREVPEPPGFTPETWE |
| Ga0126314_107993692 | 3300010042 | Serpentine Soil | MTIRRATEADEAPLRELWEEFQREVPEPTGFTPETWDE |
| Ga0134084_103055572 | 3300010322 | Grasslands Soil | VNVRPATEADERVLRELWQEFEAEVPEPPGFVADTWEE |
| Ga0134128_120670562 | 3300010373 | Terrestrial Soil | VTIRRATESDEAVLRELWEEFEAEVPEPPGFTPETWEEAWADVRR |
| Ga0134128_127036992 | 3300010373 | Terrestrial Soil | VTVRRATISDEQVLRELWEAFETEVPEPDGFQPETWEEEWAQLQEEMA |
| Ga0136449_1006079581 | 3300010379 | Peatlands Soil | VTLRLATESDEALLRELWQEFEAECPEPAGFAPESWEGAWGKIR |
| Ga0134127_131625851 | 3300010399 | Terrestrial Soil | VTVRRATEADEAILRELWEEFEREVPEPPGATPETWEEEWADVRRDI |
| Ga0126350_103384862 | 3300010880 | Boreal Forest Soil | VNIRRATEVDEATVRELWEEFEREVPFPYGDGETWEDEWKDTLD |
| Ga0133913_127744841 | 3300010885 | Freshwater Lake | VNIRQATVADEAALRELTAEYEAEVPEPPGYEPDHWAEAW |
| Ga0120157_10081211 | 3300011994 | Permafrost | VTIRRASLADEPIIRELWGEFDREVPEPPGFGESWEEAWSDLSRHVRAGF |
| Ga0120161_11299292 | 3300012005 | Permafrost | VTIRRATEADEAVLRELWQEFELELPEPEGFLPETWE |
| Ga0137377_118398221 | 3300012211 | Vadose Zone Soil | VDTSTNIRRATEADEAELRRLWADFSVEVPEPPGFPPEEW |
| Ga0157345_10517832 | 3300012498 | Arabidopsis Rhizosphere | MTIRRATEDDRELTRPLWEEFEREVPEPPGFEPETF |
| Ga0157301_100125101 | 3300012911 | Soil | MNIRPATEADQAALRELWEEFEAEIPAPPEFVETWE |
| Ga0164301_104766801 | 3300012960 | Soil | VTIRRATIFDEQVLRELWEEFENEVPEPDGFEPEAWEEEWAQ |
| Ga0134076_102353842 | 3300012976 | Grasslands Soil | VIRRATVADEPVLRELWEDFEAEIPESEGFEPETWD |
| Ga0164304_112820352 | 3300012986 | Soil | MADEALSIRRATTADEAVLRELWEEFEHEVPEPPGFTETWEQEW |
| Ga0164306_117158362 | 3300012988 | Soil | VKIRPATKADEPVLRELWEQFESELPAPPEDLETWEQEWQDVVADID |
| Ga0157370_102932683 | 3300013104 | Corn Rhizosphere | VTVRRATEADEAILREFWEEFELEVPEPVGEPETWEQEWADTVDDIRGGGVFVAEDD |
| Ga0134089_101816562 | 3300015358 | Grasslands Soil | VNVRPATEADERVLRELWQEFEAEVPEPPGFVADTWEEA |
| Ga0132256_1034734271 | 3300015372 | Arabidopsis Rhizosphere | VNVRRATEADEALLRELWQEFTAEVPEPAGTAPETWEEEWADVRADLGGG |
| Ga0187785_104991541 | 3300017947 | Tropical Peatland | VNLRRATEADQPVLRELWEEFSAEVPAPPEFVETWEEEWEDVS |
| Ga0184619_102755701 | 3300018061 | Groundwater Sediment | VRIRRATEADEATLRELWEEFEREVPAPPGFDESWEEAWIDLSRHARAGLAA |
| Ga0066669_121441712 | 3300018482 | Grasslands Soil | VNIRRATEADQATLRELWEEFTTEIPEPLDDGEPWEEEWVDT |
| Ga0193715_10923922 | 3300019878 | Soil | VRIRRATEADEAILHELWSEFELEVPAPPGFGESWEEAWSDLSRHVRAGLAAI |
| Ga0193728_10484944 | 3300019890 | Soil | VTIRHATEADKAILRELWEEFEAEVPAPQGFEPETWEQEWKDVLDDFATGAVFLA |
| Ga0193735_11136782 | 3300020006 | Soil | VRIRRATEADEPIIHELWSEFELEVPAPPGFGESWEEAWSDLSR |
| Ga0207671_108013982 | 3300025914 | Corn Rhizosphere | VTIRRATEADQAILRELWEEFEREVPEPVGEPETWEQEWA |
| Ga0207663_112326782 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MADPVTIRRATEADEAVLRALWEEFEAEVPWALEDPETWADEWPDTLEDIRDGGVFVAED |
| Ga0207660_110061061 | 3300025917 | Corn Rhizosphere | VTIRRATEADEAILRELWEEFEREVPWDIEDPETWAEEWPDTLDDIRA |
| Ga0207649_105170271 | 3300025920 | Corn Rhizosphere | VTIRRATEGDEPTLRELWEEFEREVPWDIEEPESWADEWQDTLDDIKSGGVFLA |
| Ga0207652_101869851 | 3300025921 | Corn Rhizosphere | VNIRRATEADEAELRRLWDDFSIEVPEPPGFPPEEWDEQWGVIR |
| Ga0207652_114394581 | 3300025921 | Corn Rhizosphere | MADAPLTIRRATEADEAVLRELWGEFEREVPWEVE |
| Ga0207646_105388592 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTIRAATETDEATLRELWEEFEQEVPWGLEDPETWADEWKDTLVDIRAGGVFL |
| Ga0207700_119611262 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSIRRATEADEAILRELWEEFEAEVPEPPGFVPETWEEEWSDTLDDLRDGSVF |
| Ga0207665_104811141 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVRRVTEADQELLRRLWAEFEREVPEPYGEGEPWEAEWADTLDDIRGGGVFL |
| Ga0207661_112911131 | 3300025944 | Corn Rhizosphere | MTIRRATEADEAILHELWEEFEREVPWEIEEPETWADEWPDTLEDIRAGGVFI |
| Ga0207667_102401781 | 3300025949 | Corn Rhizosphere | VTIRRATEADEAILRELWEEFEREVPEPVGEPETWAQEWG |
| Ga0207678_106400902 | 3300026067 | Corn Rhizosphere | VTIRRATEADEALLRELWEEFEREVPEPIGEPETWEQEW |
| Ga0207678_111766252 | 3300026067 | Corn Rhizosphere | VTIRRATEADEAILRELWEEFEREVPEPVGEPETWEQEWGDTHDDIRGGGVFIAE |
| Ga0207678_114248661 | 3300026067 | Corn Rhizosphere | VKIRRAAASDEAVLRELWEEFEAEVPWDLEEPETWAEEW |
| Ga0207702_105264083 | 3300026078 | Corn Rhizosphere | VTIRRATEADEAILRELWEEFEREVPWEIEDPETW |
| Ga0209155_12740152 | 3300026316 | Soil | MRIRAATEADGPVLLELWTEFEAEVPEPEGWAPETWDEAWAAFRKHIADGVVL |
| Ga0209056_105003052 | 3300026538 | Soil | VNVRPATEADERVLRELWQEFEAEVPEPPGFVADTWEEAWREIREHIASGVVLLAED |
| Ga0209474_104393721 | 3300026550 | Soil | VTIRRATEADEAVLRELWEEFEREVPWELEDPETWADEWKDTQDDLRDGGVFIAED |
| Ga0209810_11889431 | 3300027773 | Surface Soil | VTIRRATEADEAVLRELWEEFEREVPWEIEEPETWA |
| Ga0209382_113911711 | 3300027909 | Populus Rhizosphere | MNIRPATEADQAALRELWEEFEAEIPAPPEFVETWEQEWQDVSA |
| Ga0307316_103082171 | 3300028755 | Soil | VKIRRATEADEAVLRELWEEFEREVPAPPGFGESWEEAWVDLSR |
| Ga0307282_104466802 | 3300028784 | Soil | VRIRRATEADEPIIHELWSEFELEVPAPPGFGESWEEAWSDLSRHVR |
| Ga0247824_110088982 | 3300028809 | Soil | VTIRRATESDEAVLRELWEEFEREVPEPIGEGEPWEEEWSDTLDDIRGGGVFLAEDD |
| Ga0307312_103135162 | 3300028828 | Soil | VTIRRATEADEPVIRELWEEFEREVPAPPGFGETWEEAWVD |
| Ga0307277_105208171 | 3300028881 | Soil | VKVRRATEADEPVLHELWQEFNAEVPEPEGFEPESWEEEWADTRDDLA |
| Ga0307304_104415131 | 3300028885 | Soil | VTIRRATEADEPVIRELWEEFEREVPAPPGFGETWEEAWVDLSRHVRAG |
| Ga0265324_100143005 | 3300029957 | Rhizosphere | LTIRPATEADEPVLRELWEEFEQEVPWELEDPETWDDEWKDTLDDIRTGGVFLAEDGD |
| Ga0307373_101992623 | 3300031672 | Soil | VTVRLATDDDERMLRELWQEFAAEIPEPEGFPPESWEDTWPALRLE |
| Ga0318496_101955891 | 3300031713 | Soil | VKIRPATSADEPALRELWEEFEREVPEPAGWRSKTWDEEWSGLQR |
| Ga0306917_112622741 | 3300031719 | Soil | VNIRRATEADEATLRELWQEFEAEVPEPIGEPEGWDEEWRDTLDDLRGGGVFIADDD |
| Ga0308175_1021095421 | 3300031938 | Soil | VTIRRATEADQAVLRELWEEFEREVPWEVEEPETWSDEW |
| Ga0308175_1021779721 | 3300031938 | Soil | VNVRRATGADEPALRALWEEFEREVPAPRELQETWAEEWADTLANI |
| Ga0308176_117324302 | 3300031996 | Soil | MTIRRATEADEATLRGLWEEFEREVPEPDGMEPETWVEEWADTLDDVRGGGV |
| Ga0318553_101003211 | 3300032068 | Soil | VNIRPATTADETAIRELWEEFEREVPEPAGFSPETWDEEW |
| Ga0318518_100497224 | 3300032090 | Soil | VNIRPATTADETAIRELWEEFEREVPEPAGFTPETWDEEWG |
| Ga0335081_126654761 | 3300032892 | Soil | VNVRLAVESDEQVLRELWEAFEAEVPEPEGFTPETWDEEWSGLLA |
| Ga0335076_106294892 | 3300032955 | Soil | MADEALTIRPATEADEAALRSLWEEFEAETPWDVEDPET |
| Ga0335084_102891924 | 3300033004 | Soil | VNVRAATTADEASIRELWEEFEREVPEPTGFTPESWDEEW |
| ⦗Top⦘ |