Basic Information | |
---|---|
Family ID | F090685 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 41 residues |
Representative Sequence | ADKFEELVLEAFQKKVTTEVPVPPGADSIPDYPERGADAR |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.85 % |
% of genes near scaffold ends (potentially truncated) | 98.15 % |
% of genes from short scaffolds (< 2000 bps) | 94.44 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.630 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.593 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.148 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF08044 | DUF1707 | 7.41 |
PF03992 | ABM | 5.56 |
PF10604 | Polyketide_cyc2 | 4.63 |
PF13483 | Lactamase_B_3 | 2.78 |
PF07690 | MFS_1 | 1.85 |
PF07045 | DUF1330 | 1.85 |
PF13669 | Glyoxalase_4 | 1.85 |
PF11716 | MDMPI_N | 1.85 |
PF13602 | ADH_zinc_N_2 | 0.93 |
PF00005 | ABC_tran | 0.93 |
PF04191 | PEMT | 0.93 |
PF12680 | SnoaL_2 | 0.93 |
PF01208 | URO-D | 0.93 |
PF13649 | Methyltransf_25 | 0.93 |
PF01872 | RibD_C | 0.93 |
PF00069 | Pkinase | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.70 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.85 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.93 |
COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.93 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.63 % |
All Organisms | root | All Organisms | 45.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573004|GZGWRS401BKQIL | Not Available | 527 | Open in IMG/M |
3300005435|Ga0070714_100639420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1023 | Open in IMG/M |
3300005537|Ga0070730_10743834 | Not Available | 620 | Open in IMG/M |
3300005537|Ga0070730_10948595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 538 | Open in IMG/M |
3300005541|Ga0070733_10284686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1091 | Open in IMG/M |
3300005576|Ga0066708_10490136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 791 | Open in IMG/M |
3300005591|Ga0070761_10822516 | Not Available | 585 | Open in IMG/M |
3300005719|Ga0068861_102417833 | Not Available | 528 | Open in IMG/M |
3300005764|Ga0066903_101185049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1417 | Open in IMG/M |
3300005921|Ga0070766_10269864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1085 | Open in IMG/M |
3300006175|Ga0070712_101692718 | Not Available | 554 | Open in IMG/M |
3300006755|Ga0079222_11535882 | Not Available | 627 | Open in IMG/M |
3300006852|Ga0075433_10806908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 820 | Open in IMG/M |
3300009011|Ga0105251_10461795 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300009088|Ga0099830_10574245 | Not Available | 924 | Open in IMG/M |
3300009089|Ga0099828_11927424 | Not Available | 518 | Open in IMG/M |
3300009098|Ga0105245_11512799 | Not Available | 722 | Open in IMG/M |
3300009098|Ga0105245_12807475 | Not Available | 540 | Open in IMG/M |
3300009524|Ga0116225_1287061 | Not Available | 735 | Open in IMG/M |
3300009839|Ga0116223_10164286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1373 | Open in IMG/M |
3300010046|Ga0126384_12495989 | Not Available | 502 | Open in IMG/M |
3300010339|Ga0074046_10477827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
3300010339|Ga0074046_10922803 | Not Available | 506 | Open in IMG/M |
3300010366|Ga0126379_11188618 | Not Available | 869 | Open in IMG/M |
3300010373|Ga0134128_11491753 | Not Available | 744 | Open in IMG/M |
3300010379|Ga0136449_100197620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3833 | Open in IMG/M |
3300010379|Ga0136449_103483536 | Not Available | 600 | Open in IMG/M |
3300010398|Ga0126383_13256073 | Not Available | 530 | Open in IMG/M |
3300011120|Ga0150983_13574735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1270 | Open in IMG/M |
3300011269|Ga0137392_11234826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
3300012209|Ga0137379_10339924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. Kera 3 | 1411 | Open in IMG/M |
3300012211|Ga0137377_11349906 | Not Available | 642 | Open in IMG/M |
3300012957|Ga0164303_10023994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2402 | Open in IMG/M |
3300012985|Ga0164308_10843430 | Not Available | 802 | Open in IMG/M |
3300014968|Ga0157379_12043314 | Not Available | 567 | Open in IMG/M |
3300015373|Ga0132257_102682398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 649 | Open in IMG/M |
3300016357|Ga0182032_11721166 | Not Available | 547 | Open in IMG/M |
3300016371|Ga0182034_11271272 | Not Available | 641 | Open in IMG/M |
3300017926|Ga0187807_1121117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MMG1121 | 829 | Open in IMG/M |
3300017928|Ga0187806_1042294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
3300017959|Ga0187779_10337158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 972 | Open in IMG/M |
3300017972|Ga0187781_11085672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 587 | Open in IMG/M |
3300017974|Ga0187777_10295238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1107 | Open in IMG/M |
3300017974|Ga0187777_11225577 | Not Available | 549 | Open in IMG/M |
3300018001|Ga0187815_10453965 | Not Available | 547 | Open in IMG/M |
3300018025|Ga0187885_10537748 | Not Available | 520 | Open in IMG/M |
3300018042|Ga0187871_10356428 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300018046|Ga0187851_10814113 | Not Available | 525 | Open in IMG/M |
3300020582|Ga0210395_10485553 | Not Available | 929 | Open in IMG/M |
3300020583|Ga0210401_10987258 | Not Available | 701 | Open in IMG/M |
3300021362|Ga0213882_10516559 | Not Available | 512 | Open in IMG/M |
3300021407|Ga0210383_10139710 | Not Available | 2055 | Open in IMG/M |
3300021407|Ga0210383_11369474 | Not Available | 589 | Open in IMG/M |
3300021559|Ga0210409_10385909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1255 | Open in IMG/M |
3300021560|Ga0126371_13352050 | Not Available | 541 | Open in IMG/M |
3300024290|Ga0247667_1102200 | Not Available | 528 | Open in IMG/M |
3300025634|Ga0208589_1085945 | Not Available | 752 | Open in IMG/M |
3300025939|Ga0207665_10955838 | Not Available | 681 | Open in IMG/M |
3300026078|Ga0207702_11131256 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300026551|Ga0209648_10706852 | Not Available | 550 | Open in IMG/M |
3300027867|Ga0209167_10286298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
3300027879|Ga0209169_10307009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300027882|Ga0209590_10405110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
3300027905|Ga0209415_10046898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5667 | Open in IMG/M |
3300028747|Ga0302219_10388609 | Not Available | 546 | Open in IMG/M |
3300028808|Ga0302228_10272823 | Not Available | 760 | Open in IMG/M |
3300028877|Ga0302235_10161659 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300028879|Ga0302229_10206816 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300029999|Ga0311339_11286989 | Not Available | 664 | Open in IMG/M |
3300030013|Ga0302178_10229531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300030013|Ga0302178_10461853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Iamia → unclassified Iamia → Iamia sp. SCSIO 61187 | 558 | Open in IMG/M |
3300030057|Ga0302176_10339303 | Not Available | 605 | Open in IMG/M |
3300030490|Ga0302184_10127426 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300030490|Ga0302184_10238446 | Not Available | 748 | Open in IMG/M |
3300030503|Ga0311370_10664294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
3300030580|Ga0311355_10044335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5285 | Open in IMG/M |
3300030706|Ga0310039_10268895 | Not Available | 653 | Open in IMG/M |
3300030906|Ga0302314_10745294 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300031027|Ga0302308_10003973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11703 | Open in IMG/M |
3300031028|Ga0302180_10614055 | Not Available | 522 | Open in IMG/M |
3300031234|Ga0302325_13104494 | Not Available | 533 | Open in IMG/M |
3300031525|Ga0302326_10835922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1320 | Open in IMG/M |
3300031525|Ga0302326_13535341 | Not Available | 518 | Open in IMG/M |
3300031543|Ga0318516_10140576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1384 | Open in IMG/M |
3300031679|Ga0318561_10671976 | Not Available | 570 | Open in IMG/M |
3300031680|Ga0318574_10738998 | Not Available | 577 | Open in IMG/M |
3300031708|Ga0310686_102436342 | Not Available | 512 | Open in IMG/M |
3300031708|Ga0310686_106229375 | Not Available | 702 | Open in IMG/M |
3300031736|Ga0318501_10281609 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300031747|Ga0318502_10626640 | Not Available | 648 | Open in IMG/M |
3300031751|Ga0318494_10794819 | Not Available | 554 | Open in IMG/M |
3300031805|Ga0318497_10178731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1169 | Open in IMG/M |
3300031805|Ga0318497_10459958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Spongiactinospora → Spongiactinospora gelatinilytica | 713 | Open in IMG/M |
3300031833|Ga0310917_10736798 | Not Available | 667 | Open in IMG/M |
3300031846|Ga0318512_10470753 | Not Available | 635 | Open in IMG/M |
3300031879|Ga0306919_10281721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1257 | Open in IMG/M |
3300031894|Ga0318522_10351739 | Not Available | 558 | Open in IMG/M |
3300032001|Ga0306922_12278919 | Not Available | 520 | Open in IMG/M |
3300032008|Ga0318562_10467332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
3300032067|Ga0318524_10520428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300032076|Ga0306924_11902561 | Not Available | 617 | Open in IMG/M |
3300032160|Ga0311301_11824016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
3300032770|Ga0335085_12293552 | Not Available | 540 | Open in IMG/M |
3300032782|Ga0335082_11390508 | Not Available | 572 | Open in IMG/M |
3300032828|Ga0335080_11631767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300032892|Ga0335081_11595116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 717 | Open in IMG/M |
3300033134|Ga0335073_11239806 | Not Available | 744 | Open in IMG/M |
3300033158|Ga0335077_10401958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1471 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.59% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 16.67% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.70% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FG2_01601470 | 2189573004 | Grass Soil | QVDEFEKMILKGFPAKGIRRRSNPLGAADISAYPERGSDGR |
Ga0070714_1006394201 | 3300005435 | Agricultural Soil | QVDEFEKMILKAFQKKVSADVPIPPGATDFPDYPERGSDGR* |
Ga0070730_107438341 | 3300005537 | Surface Soil | LRTQRADEFEKMVLKAFQRKVSAEVPIPPGAADIPDYSERDAR* |
Ga0070730_109485951 | 3300005537 | Surface Soil | EEMVLEAFQKKVTAEVPVPPGSVGIPDYPERGTDAR* |
Ga0070733_102846861 | 3300005541 | Surface Soil | LRTLQADALEELLLEAFQKKITAEVPVPPGAADIPHNPKRGTDAR* |
Ga0066708_104901362 | 3300005576 | Soil | LRSGRLDEFERMVLKAFQRKVSAEVPVPLGATDVPEYPERKPNAG* |
Ga0070761_108225163 | 3300005591 | Soil | EFEKLVLKAFQRKVSAEVPIPPGAEDIPDYSKRDVDAR* |
Ga0068861_1024178333 | 3300005719 | Switchgrass Rhizosphere | FEELVLEAFQRKVAADVPVPSGATDIPDYPERSADAR* |
Ga0066903_1011850491 | 3300005764 | Tropical Forest Soil | RLRTYQADEFEKMVLKAFQRKVSSEVPIPPGATDIPDYSERGADAR* |
Ga0070766_102698643 | 3300005921 | Soil | ERIRAGRPDKFEQMVLEAFQKKVAVEVPLPPGAVEIPDYPKRGIDAR* |
Ga0070712_1016927181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LRTRQPDKFEQMVLEAFQKKVSADVPVPPGASDIPDYP* |
Ga0079222_115358823 | 3300006755 | Agricultural Soil | KRLRTKQADMFEELVLEAIQRKVSADVPVPSGATDIPDYPERKADAR* |
Ga0075433_108069081 | 3300006852 | Populus Rhizosphere | RQPDKFEQMVLEAFQKKVSADVPVPPGASDIPDYP* |
Ga0105251_104617951 | 3300009011 | Switchgrass Rhizosphere | QANKFEELILEAFQAKVAAQVPVPPGADSISDYPERGRDAG* |
Ga0099830_105742454 | 3300009088 | Vadose Zone Soil | RSQQADSFEELVLEAFQKKVTAEVPVPPGADSIPDYPERGPDAR* |
Ga0099828_119274242 | 3300009089 | Vadose Zone Soil | ERLRTQQADEFEKMVLKAFQRKVSAEIPVPPGAADIPDYPERGADAR* |
Ga0105245_115127993 | 3300009098 | Miscanthus Rhizosphere | EFEKMVLKAFQRKVSADVPAPLGSMDIRDYPERNPNAG* |
Ga0105245_128074751 | 3300009098 | Miscanthus Rhizosphere | RTHQADKFEQIVLEAFEKKVAAEVPVPPGAADIPDYP* |
Ga0116225_12870612 | 3300009524 | Peatlands Soil | LRSRQSDKPDKFEQMVLEAFQKKVTAEVPVPPGADGIPDYPERGADAR* |
Ga0116223_101642863 | 3300009839 | Peatlands Soil | TKQAVVFEGRVMEAFQKKVTAEVPVPPRATDIPDYLMRGADAR* |
Ga0126384_124959891 | 3300010046 | Tropical Forest Soil | HDAYKQLRTQQVDEFEKMVLRAFQRKVSADVPTPLGAADISADLERGSDGR* |
Ga0074046_104778271 | 3300010339 | Bog Forest Soil | FEELVLEAFQKKVTAEVPVPPGVDSIPDYPERGADAR* |
Ga0074046_109228031 | 3300010339 | Bog Forest Soil | ELEIMVLRAFQREVSAAIPVPPGAEDIPDYPERGRNAG* |
Ga0126379_111886182 | 3300010366 | Tropical Forest Soil | YKRLRTQQADALEELVLEAFQRKVCADVPVPAGATDIPDYP* |
Ga0134128_114917533 | 3300010373 | Terrestrial Soil | DEFEKMVLKAFQRKVSADVPAPLGATDIPDYPERKPNAG* |
Ga0136449_1001976201 | 3300010379 | Peatlands Soil | ERLRSHRADAFEELVLEAFQKKVTGEVPVPPGADDIPDYPERGADAR* |
Ga0136449_1034835362 | 3300010379 | Peatlands Soil | LRSHQADAFEELVLEAFQKKVTAEVPVPAGAESIPDHPERDADAR* |
Ga0126383_132560733 | 3300010398 | Tropical Forest Soil | THQADIFEELVLEAFQAKIVGEVPVPPGAVDVPDCP* |
Ga0150983_135747351 | 3300011120 | Forest Soil | VDEFEKMVLKAFQRKVSADVPIPPGATDIPDYPERGSDGR* |
Ga0137392_112348261 | 3300011269 | Vadose Zone Soil | LVLEAFQKKVTAEVPVPPGADGIPDYPERGADAR* |
Ga0137379_103399244 | 3300012209 | Vadose Zone Soil | DLVLEAFQKKVTAEVPVPLGADGIPDYPERGADAR* |
Ga0137377_113499061 | 3300012211 | Vadose Zone Soil | FEQMVLEAFQRKVTGEVPVPRGAADIPDYPERGSDAR* |
Ga0164303_100239941 | 3300012957 | Soil | QQVDEFEKMVLKAFQRKVSADVPTPLGAADISAYPKRGSDGR* |
Ga0164308_108434301 | 3300012985 | Soil | NQRVDAFEKMVLKAFQRKVSADVPIPPGAADIPDYPERGSDAR* |
Ga0157379_120433142 | 3300014968 | Switchgrass Rhizosphere | RSGQLDEFEKMVLKAFQRKVSADVPAPLGSMDIRDYPERNPNAG* |
Ga0132257_1026823982 | 3300015373 | Arabidopsis Rhizosphere | MVLEAFEAKVTAEVPVPPGATDIPNYPERVADAR* |
Ga0182032_117211661 | 3300016357 | Soil | QADEFEKMVLKAFQRKVSAGVPVPHGATDIPDYSERDADAR |
Ga0182034_112712723 | 3300016371 | Soil | KQADAFEELVLEAFQKKVTSDVPVPPGATDIPDYLERSADAR |
Ga0187807_11211171 | 3300017926 | Freshwater Sediment | RLRIKQADKFEQMVLEAFQAKVTAEVPVPPGATDIPNYP |
Ga0187806_10422941 | 3300017928 | Freshwater Sediment | YERIRSKQADAFEELVLEAFQKKVTADVPVPPGAADIPDYRKEA |
Ga0187779_103371581 | 3300017959 | Tropical Peatland | ELEQLVLEAFQRKVTADVPIPPRATDIPDYRQRGVDAR |
Ga0187781_110856721 | 3300017972 | Tropical Peatland | QTQRPDKLEQMVLEAFQRKVTAEIPVPYGAADIPDYPERGSDAR |
Ga0187777_102952381 | 3300017974 | Tropical Peatland | ERLRSEPKPDPFEQMVLEAFQKKITVEVPIPPGAADIPDYSKRDTDAR |
Ga0187777_112255771 | 3300017974 | Tropical Peatland | QADEFEKMVLKAFQRNVSAEVPVPLGATDVPDYSERDADAR |
Ga0187815_104539651 | 3300018001 | Freshwater Sediment | KQADKFEQMVLEAFQAKVTAEVPVPPGATDIPDYP |
Ga0187885_105377481 | 3300018025 | Peatland | RLRSKQADVLEDLVLEAFQKKVTAEVPVPSGADGIPDYPERKADAR |
Ga0187871_103564283 | 3300018042 | Peatland | ELVLEAFQKKVTGEVPVPPGADGIPDYPERRADAR |
Ga0187851_108141132 | 3300018046 | Peatland | DEFEKMVLKAFQQRVSAEIPVPPGAADIPDYPERGADAR |
Ga0210395_104855531 | 3300020582 | Soil | ERLRSHQADAFEEMVLHAFQRKVATEVPVPPGAADIPEYPERVNAR |
Ga0210401_109872583 | 3300020583 | Soil | QADEFEKMVLKAFQRKVSAEVPVPPGAADIPDYSERDADAR |
Ga0213882_105165592 | 3300021362 | Exposed Rock | ERLRTKKANKFEELVLEAFQSKVSAEVPVPPGAIDIPDYLQRGTDAK |
Ga0210383_101397101 | 3300021407 | Soil | QMVLEAFQKKVVSEIPVPPGALDIPDYSRRGVDAR |
Ga0210383_113694741 | 3300021407 | Soil | EELVLEAFQKRVSCAVPVPAGAADIPDYPERKRHAR |
Ga0210409_103859091 | 3300021559 | Soil | VDEFEKMVLKAFQRKVSADVPIPPGATDIPDYPERGSDGR |
Ga0126371_133520501 | 3300021560 | Tropical Forest Soil | LRTHQADKFEQMVLEAFQNKVTAEVPIPPGAADIPDYP |
Ga0247667_11022002 | 3300024290 | Soil | DAYDRIRSHQADKFEQIVLEAFQKKVADDVPTPPGAADIPDYP |
Ga0208589_10859451 | 3300025634 | Arctic Peat Soil | FEELVLEAFQKKVTADVPLPPGAADIPDYPERGADAR |
Ga0207665_109558383 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RCRTNQADEFEKMVLNAFQRKVSTEVAVPPGAVDIPDYP |
Ga0207702_111312563 | 3300026078 | Corn Rhizosphere | FEKMVLKAFQRKVSAEVPVPPHAAAIPDYPERDADAR |
Ga0209648_107068523 | 3300026551 | Grasslands Soil | SQQADKFEELVLEAFQRKVTGDVPVPPGAADIPDYP |
Ga0209167_102862983 | 3300027867 | Surface Soil | ADEFEEMVLEAFQRKVSAAVPVPPGAAEIPDYPERGPDAGQGHLLRDR |
Ga0209169_103070091 | 3300027879 | Soil | ADMFEELVLEAFQKKVTAEVPVPRGSDGIPDYPERKADAR |
Ga0209590_104051101 | 3300027882 | Vadose Zone Soil | RSQQADSFEELVLEAFQKKVTAEVPVPPGADSIPDCPERGADAR |
Ga0209415_100468987 | 3300027905 | Peatlands Soil | ADKFEELVLEAFQKKVTTEVPVPPGADSIPDYPERGADAR |
Ga0302219_103886091 | 3300028747 | Palsa | GQPDKFEQMVLEAFQKKVTAEVSVPFGAESIPDYSERKADAR |
Ga0302228_102728231 | 3300028808 | Palsa | TQQADKFEQMVLEAFQKKVTADVPVPLGAESIPDYPERKADAR |
Ga0302235_101616591 | 3300028877 | Palsa | LRTGQPDKFEQMVLEAFQKKVIAEVPIPSGADGIPDYPERKADAR |
Ga0302229_102068163 | 3300028879 | Palsa | ADAFEELVLEAFQKKVTADVPVPSGADGIPDYAERKADAG |
Ga0311339_112869893 | 3300029999 | Palsa | KQADIFEELVLEAFQKKVTAEVPVPSGADGIPDYPERKADAR |
Ga0302178_102295311 | 3300030013 | Palsa | SKQADMFEELVLEAFQKKVTAEVPVPSGADGIPDYSERKADAR |
Ga0302178_104618533 | 3300030013 | Palsa | KLEQLLLEAFQKKVTADVPVPPGAADIPDYPKRGADAG |
Ga0302176_103393032 | 3300030057 | Palsa | SLEELVLEAFQKKVAAEVPVPLGAESIPDYPERKADAR |
Ga0302184_101274261 | 3300030490 | Palsa | QPDKFEQMVLEAFQKKVIAEVPIPSGADGIPDYPERKADAR |
Ga0302184_102384461 | 3300030490 | Palsa | FEELVLEAFQKKVTAEVPVPPGADGIPDYPERKADAR |
Ga0311370_106642944 | 3300030503 | Palsa | ERLRSKQADQFEELVLEAFQKKVTAEVPVPLGAESIPDYPERKADAR |
Ga0311355_100443357 | 3300030580 | Palsa | ERLRTQQADKFEQMVLEAFQKKVTADVPVPLGAESIPDYPERKADAR |
Ga0310039_102688952 | 3300030706 | Peatlands Soil | QADAFEELVLEAFQKKVTAEVPVPAGAESIPDHPERDADAR |
Ga0302314_107452941 | 3300030906 | Palsa | RTGQPDKFEQMVLEAFQKKVIAEVPIPSGADGIPDYPERKADAR |
Ga0302308_1000397313 | 3300031027 | Palsa | FEELVLEAFQKKVTAEVPVPLGAESIPDYPERGADAR |
Ga0302180_106140552 | 3300031028 | Palsa | KFEELVLEAFQKKVTAEVPVPPGAGGIPDYPERVTDAR |
Ga0302325_131044942 | 3300031234 | Palsa | RSQQADKFEQMVLEAFQKKVTADVPVPPGADSIPDYQKRGSDAR |
Ga0302326_108359224 | 3300031525 | Palsa | LEELVLEAFQKKVTAEVPVPPGADGIPDYPERGRDAR |
Ga0302326_135353412 | 3300031525 | Palsa | YERLRSKQADKFEELVLEAFQKKVTAEVPVPPGADGIPDYPERGADAR |
Ga0318516_101405764 | 3300031543 | Soil | TQKADKFEELVLEAFEKKVTADVPVPPGAADVNGYIKRGADAR |
Ga0318561_106719763 | 3300031679 | Soil | AFEELVLEAFQKKVTAEVPVPPGANDIPDYPERGRYAG |
Ga0318574_107389982 | 3300031680 | Soil | KRLRTHQADKFEQMVLEAFQKKVSADVPIPPGAADIPDYP |
Ga0310686_1024363421 | 3300031708 | Soil | ELVLEAFEKKVTSEVPVPSGAADISDYPKRGTDAR |
Ga0310686_1062293752 | 3300031708 | Soil | AYERLRTQQADKFEELVLEAFQKKVSADVPVPRGAADIPDYP |
Ga0318501_102816091 | 3300031736 | Soil | GDEFEKMVLKAFQRKVSAEVPVPPGATDIPDYSERDADAR |
Ga0318502_106266402 | 3300031747 | Soil | YKRLRTHQADKFEQMVLEAFQKKVSADVPIPPGAADIPDYP |
Ga0318494_107948192 | 3300031751 | Soil | LRTHQADKFEQIVLEAFQKKVAADVPIPPGAEDIPDYP |
Ga0318497_101787311 | 3300031805 | Soil | THQADKFEHMVLEAFQKKVSADVPVPPGATDIPDHP |
Ga0318497_104599581 | 3300031805 | Soil | ERLRSKQADVFEELVLEAFQKKVAGEVPVPPGAADIPDYP |
Ga0310917_107367983 | 3300031833 | Soil | EEMVLEAFQKKVAAEVPVPPGAADIPDYPKRGRDAR |
Ga0318512_104707531 | 3300031846 | Soil | RTHQADKFEQMVLEAFQKKVSADVPIPPGAADIPDYP |
Ga0306919_102817211 | 3300031879 | Soil | ELVLEAFEKKVTADVPVPPGAADVNGYIKRGADAR |
Ga0318522_103517391 | 3300031894 | Soil | LRTHQPDKFEQMVLEAFQRKVTADVPVPSGATDIPDHP |
Ga0306922_122789192 | 3300032001 | Soil | ADKFEELVLEAFQRKVTADVPIPPGAVDIPDYPKRGTDAR |
Ga0318562_104673321 | 3300032008 | Soil | RTHQADVFEELVLEAFQRKVSADVPVPNGATDVPDHP |
Ga0318524_105204283 | 3300032067 | Soil | RIRSKQADTFEDLVLEAFQKKVTADVPVPPGAADIPDHRKEA |
Ga0306924_119025613 | 3300032076 | Soil | QADEFEKMVLKAFQRKVSAEIPIPLGAADIPGYSERDADAR |
Ga0311301_118240161 | 3300032160 | Peatlands Soil | ERIRSKQADALEELVLEAFQKKVTADVPVPPGAADIPDYRKEA |
Ga0335085_122935521 | 3300032770 | Soil | YERLRTHQADKFEQMVLEAFQKKVSADVAIPPGAADIPDYS |
Ga0335082_113905082 | 3300032782 | Soil | YEQIRTGQVDEFERMVLKAFQRKVSAEIPIPPGAVDIPDYPERGADAR |
Ga0335080_116317673 | 3300032828 | Soil | IRTKQANKFEQMVLEAFQGKVTADVPVPLGATDVPDYP |
Ga0335081_115951161 | 3300032892 | Soil | DEFEKMILKAFQRKVSAEISVPPGAADIPNCSERGTDAR |
Ga0335073_112398063 | 3300033134 | Soil | EFEKMVLKAFQRKVSSEVPVPPGATDIPDYPERSADAR |
Ga0335077_104019584 | 3300033158 | Soil | AYKRLWSHQADKFEELVLEAFQKKVAAEVPVPPGAADIPDYP |
⦗Top⦘ |