| Basic Information | |
|---|---|
| Family ID | F090623 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 93.52 % |
| % of genes from short scaffolds (< 2000 bps) | 89.81 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.407 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.037 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00182 | Glyco_hydro_19 | 0.93 |
| PF11351 | GTA_holin_3TM | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.93 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.48 % |
| Unclassified | root | N/A | 18.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10223407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 613 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10203254 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 633 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10254508 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 533 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10178607 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 672 | Open in IMG/M |
| 3300001347|JGI20156J14371_10106631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300003621|JGI26083J51738_10127292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 531 | Open in IMG/M |
| 3300004448|Ga0065861_1001766 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 710 | Open in IMG/M |
| 3300006025|Ga0075474_10136399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 775 | Open in IMG/M |
| 3300006027|Ga0075462_10125357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 791 | Open in IMG/M |
| 3300006027|Ga0075462_10131705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 768 | Open in IMG/M |
| 3300006190|Ga0075446_10037226 | Not Available | 1548 | Open in IMG/M |
| 3300006752|Ga0098048_1263293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 503 | Open in IMG/M |
| 3300006803|Ga0075467_10679191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300006868|Ga0075481_10043808 | Not Available | 1724 | Open in IMG/M |
| 3300006916|Ga0070750_10320776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 659 | Open in IMG/M |
| 3300006919|Ga0070746_10232138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 867 | Open in IMG/M |
| 3300006920|Ga0070748_1343275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 527 | Open in IMG/M |
| 3300006947|Ga0075444_10251817 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 694 | Open in IMG/M |
| 3300007229|Ga0075468_10166417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 659 | Open in IMG/M |
| 3300007229|Ga0075468_10232027 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 528 | Open in IMG/M |
| 3300007344|Ga0070745_1257448 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 630 | Open in IMG/M |
| 3300007538|Ga0099851_1226314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 674 | Open in IMG/M |
| 3300007540|Ga0099847_1115613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 810 | Open in IMG/M |
| 3300007541|Ga0099848_1227088 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 661 | Open in IMG/M |
| 3300007640|Ga0070751_1294451 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300008012|Ga0075480_10282427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 848 | Open in IMG/M |
| 3300008012|Ga0075480_10502465 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 584 | Open in IMG/M |
| 3300008964|Ga0102889_1219860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 551 | Open in IMG/M |
| 3300008999|Ga0102816_1218220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 598 | Open in IMG/M |
| 3300009000|Ga0102960_1238822 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 644 | Open in IMG/M |
| 3300009071|Ga0115566_10339986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 877 | Open in IMG/M |
| 3300009079|Ga0102814_10844892 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 507 | Open in IMG/M |
| 3300009124|Ga0118687_10026315 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300009599|Ga0115103_1401312 | Not Available | 1165 | Open in IMG/M |
| 3300010368|Ga0129324_10273067 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 670 | Open in IMG/M |
| 3300010392|Ga0118731_112552738 | Not Available | 976 | Open in IMG/M |
| 3300011252|Ga0151674_1015171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 840 | Open in IMG/M |
| 3300012528|Ga0129352_10337895 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300013010|Ga0129327_10071949 | Not Available | 1706 | Open in IMG/M |
| 3300017697|Ga0180120_10272289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 683 | Open in IMG/M |
| 3300017713|Ga0181391_1029123 | Not Available | 1351 | Open in IMG/M |
| 3300017713|Ga0181391_1067529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 826 | Open in IMG/M |
| 3300017713|Ga0181391_1094843 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 676 | Open in IMG/M |
| 3300017727|Ga0181401_1154442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 558 | Open in IMG/M |
| 3300017779|Ga0181395_1166969 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 690 | Open in IMG/M |
| 3300018413|Ga0181560_10271213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 801 | Open in IMG/M |
| 3300018413|Ga0181560_10527673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 536 | Open in IMG/M |
| 3300019765|Ga0194024_1004650 | Not Available | 2819 | Open in IMG/M |
| 3300020013|Ga0182086_1275989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 1244 | Open in IMG/M |
| 3300020165|Ga0206125_10251609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 672 | Open in IMG/M |
| 3300020438|Ga0211576_10172694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 1160 | Open in IMG/M |
| 3300021185|Ga0206682_10050352 | All Organisms → Viruses → Predicted Viral | 2279 | Open in IMG/M |
| 3300021335|Ga0213867_1067515 | Not Available | 1332 | Open in IMG/M |
| 3300021373|Ga0213865_10191667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 1017 | Open in IMG/M |
| 3300021378|Ga0213861_10383816 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 695 | Open in IMG/M |
| 3300021378|Ga0213861_10544248 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 543 | Open in IMG/M |
| 3300021425|Ga0213866_10159855 | Not Available | 1190 | Open in IMG/M |
| 3300021425|Ga0213866_10366318 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 709 | Open in IMG/M |
| 3300022178|Ga0196887_1109289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 608 | Open in IMG/M |
| 3300022218|Ga0224502_10339135 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 581 | Open in IMG/M |
| 3300022223|Ga0224501_10408127 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 669 | Open in IMG/M |
| 3300022922|Ga0255779_1134940 | Not Available | 1200 | Open in IMG/M |
| 3300022923|Ga0255783_10283645 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 683 | Open in IMG/M |
| (restricted) 3300023114|Ga0233405_10030767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 794 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10230604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 808 | Open in IMG/M |
| 3300024319|Ga0228670_1020133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1733 | Open in IMG/M |
| 3300024326|Ga0228652_1016388 | All Organisms → Viruses → Predicted Viral | 2213 | Open in IMG/M |
| 3300024326|Ga0228652_1022549 | All Organisms → Viruses → Predicted Viral | 1816 | Open in IMG/M |
| 3300024329|Ga0228631_1142312 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 532 | Open in IMG/M |
| 3300024335|Ga0228672_1118794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 719 | Open in IMG/M |
| 3300024433|Ga0209986_10272377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 812 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10386686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 583 | Open in IMG/M |
| 3300025083|Ga0208791_1054896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 686 | Open in IMG/M |
| 3300025084|Ga0208298_1020180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 1485 | Open in IMG/M |
| 3300025108|Ga0208793_1142770 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 638 | Open in IMG/M |
| 3300025655|Ga0208795_1006457 | Not Available | 4400 | Open in IMG/M |
| 3300025668|Ga0209251_1110501 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 769 | Open in IMG/M |
| 3300025674|Ga0208162_1004746 | All Organisms → cellular organisms → Bacteria | 6346 | Open in IMG/M |
| 3300025759|Ga0208899_1199009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 638 | Open in IMG/M |
| 3300025767|Ga0209137_1289503 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 501 | Open in IMG/M |
| 3300025769|Ga0208767_1076164 | Not Available | 1431 | Open in IMG/M |
| 3300025771|Ga0208427_1062360 | Not Available | 1347 | Open in IMG/M |
| 3300025806|Ga0208545_1147100 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 566 | Open in IMG/M |
| 3300025840|Ga0208917_1229054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 606 | Open in IMG/M |
| 3300025869|Ga0209308_10312703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 652 | Open in IMG/M |
| 3300026453|Ga0228644_1099444 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 500 | Open in IMG/M |
| 3300026471|Ga0247602_1050108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA4812 | 1167 | Open in IMG/M |
| 3300026483|Ga0228620_1013269 | All Organisms → Viruses → Predicted Viral | 2216 | Open in IMG/M |
| 3300026503|Ga0247605_1049270 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300026513|Ga0247590_1113238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 700 | Open in IMG/M |
| 3300027170|Ga0208963_1061353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 563 | Open in IMG/M |
| 3300027298|Ga0208970_1076779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 540 | Open in IMG/M |
| 3300027714|Ga0209815_1197494 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 622 | Open in IMG/M |
| 3300027833|Ga0209092_10638211 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 529 | Open in IMG/M |
| 3300028129|Ga0228634_1075005 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 793 | Open in IMG/M |
| 3300028136|Ga0228608_1080827 | Not Available | 921 | Open in IMG/M |
| 3300028414|Ga0228627_1113819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 615 | Open in IMG/M |
| 3300028419|Ga0228625_1008193 | All Organisms → Viruses → Predicted Viral | 2837 | Open in IMG/M |
| 3300031702|Ga0307998_1045337 | Not Available | 1763 | Open in IMG/M |
| 3300032257|Ga0316205_10218609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 701 | Open in IMG/M |
| 3300032274|Ga0316203_1187401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 570 | Open in IMG/M |
| 3300032277|Ga0316202_10333769 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 707 | Open in IMG/M |
| 3300033742|Ga0314858_066975 | Not Available | 889 | Open in IMG/M |
| 3300033742|Ga0314858_093126 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 761 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 20.37% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.56% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.56% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.63% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.63% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.70% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.78% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.85% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.85% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.93% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.93% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300003428 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020013 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023114 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023699 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
| 3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027170 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300028419 | Seawater microbial communities from Monterey Bay, California, United States - 30D | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102234071 | 3300000101 | Marine | VKAGAKKRQVGNDANRKKAQQRLQKTGSIDDALSLIIGDS* |
| DelMOSpr2010_102032541 | 3300000116 | Marine | ARPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| DelMOSpr2010_102545081 | 3300000116 | Marine | VVKAGAKKRQVGNDANRKKAQQRLQKTGSIDDALNLIIGDS* |
| DelMOWin2010_101786072 | 3300000117 | Marine | RPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| JGI20156J14371_101066311 | 3300001347 | Pelagic Marine | AGAAKRKDGDAVTRNKAQARLQKTGSIDDALSLILNQ* |
| JGI26111J50215_10220262 | 3300003428 | Marine | TQTKGEKARPVVKAGVKKRKSTGIQAEQQKAQQRLMKTGSIDDALSLMLNND* |
| JGI26083J51738_101272921 | 3300003621 | Marine | VRAGAKKTPDGQAATRKKAQSRLQKTGSINDALGLILNS* |
| Ga0065861_10017662 | 3300004448 | Marine | PVVKPGAKKRQVGNNATRKKAQQRLQKTGSIDDALSLIINDS* |
| Ga0075474_101363991 | 3300006025 | Aqueous | KKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0075462_101253572 | 3300006027 | Aqueous | RPVVKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0075462_101317052 | 3300006027 | Aqueous | AKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0075446_100372264 | 3300006190 | Marine | KKRQDNNVVTRKKAQARLQKTGSIEDALSLILKQ* |
| Ga0098048_12632931 | 3300006752 | Marine | PVVKAGAKKRVDSSAATRKKAQQRLQKTGSVEDALSLILNQSVFERTH* |
| Ga0075467_106791911 | 3300006803 | Aqueous | KYRQLVANKQKSQSKADGVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0075481_100438081 | 3300006868 | Aqueous | KADGVRPVVKAGAKKRPDGQAATRKKAHQRLQKTGSIDDALSLMLKS* |
| Ga0070750_103207762 | 3300006916 | Aqueous | KSQSKADGARPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0070746_102321382 | 3300006919 | Aqueous | VRAGAKKRPENAAATNRKKAQQRLQKSGRIEDAIDLIMNS* |
| Ga0070748_13432751 | 3300006920 | Aqueous | KKRQDGNAANRKKAQQRLQKTGSIDDALNLIIGDS* |
| Ga0075444_102518172 | 3300006947 | Marine | VKAGAKKTADSKANTRKKAQQRLQKSGSINDALSLMLNS* |
| Ga0075468_101664172 | 3300007229 | Aqueous | QLVANKQKSQSKADGVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0075468_102320272 | 3300007229 | Aqueous | AKKRQDGNAANRKKAQQRLQKTGSIDDALNLIIGDS* |
| Ga0070745_12574481 | 3300007344 | Aqueous | AKGVRPVVKAGAKKRPDGQAATRKKAQQRLQKSGSIDDALSLMLKS* |
| Ga0099851_12263142 | 3300007538 | Aqueous | GAKKRPDGQAATRKKAHQRLQKTGSIDDALSLMLKS* |
| Ga0099847_11156132 | 3300007540 | Aqueous | AGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0099848_12270881 | 3300007541 | Aqueous | KAMQKGEGALPMAKAGAKKRQDGNVATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0070751_12944511 | 3300007640 | Aqueous | KAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0075480_102824272 | 3300008012 | Aqueous | VKAGAKKRRNPGKAAARKTAQTRLQKSGSINDALNLILDS* |
| Ga0075480_105024651 | 3300008012 | Aqueous | QLVANRKKSQSKADGARPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0102889_12198601 | 3300008964 | Estuarine | GVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0102816_12182201 | 3300008999 | Estuarine | ARPVVKPGAKKRQVGNNATRKKAQQRLQKTGSIDDALSLIINDS* |
| Ga0102960_12388221 | 3300009000 | Pond Water | GEGALPMAKAGAKKRQDGNVATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0115566_103399862 | 3300009071 | Pelagic Marine | VKAGAKKRNDGNAATRNKAKTRLQKTGSIDDALSLILNQ* |
| Ga0102814_108448921 | 3300009079 | Estuarine | KKTPDGQAATRKKAQSRLQKTGSINDALGLILNS* |
| Ga0118687_100263155 | 3300009124 | Sediment | VRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0115103_14013121 | 3300009599 | Marine | GAKKRQEGNSATRKKAQQRLQKTGSIDDALNLIIGDS* |
| Ga0129324_102730671 | 3300010368 | Freshwater To Marine Saline Gradient | GVRPVVKAGAKKRPDGQAATRKKAQQRLQKSGSIDDALSLMLKS* |
| Ga0118731_1125527382 | 3300010392 | Marine | PVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0151674_10151711 | 3300011252 | Marine | QKSQSKADGVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS* |
| Ga0129352_103378951 | 3300012528 | Aqueous | RTEGQAATRSKAQQKLRKSGSIDDALSLMIDSNL* |
| Ga0129327_100719491 | 3300013010 | Freshwater To Marine Saline Gradient | KKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS* |
| Ga0180120_102722892 | 3300017697 | Freshwater To Marine Saline Gradient | VVKAGAKKRQDGNAANRKKAQQRLQKTGSIDDALNLIIGES |
| Ga0181391_10291233 | 3300017713 | Seawater | AKKRPDGQAATRKKAQQRLQKSGSIDDALSLMLKS |
| Ga0181391_10675291 | 3300017713 | Seawater | GAKKTADGNAATRKKAKTRLQKTGSIDDALGLIINS |
| Ga0181391_10948432 | 3300017713 | Seawater | SQSKADGVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0181401_11544421 | 3300017727 | Seawater | RPVVKAGAKKRQDGNVATRKKAQQRLQKTGSIDDALNLIIGNS |
| Ga0181395_11669691 | 3300017779 | Seawater | AGAKKRQDGNAATRTKAQSRLQKTGSIDDAVNLIFNS |
| Ga0181560_102712132 | 3300018413 | Salt Marsh | KAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| Ga0181560_105276731 | 3300018413 | Salt Marsh | QKSQSKADGARPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| Ga0194024_10046507 | 3300019765 | Freshwater | GAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0182086_12759891 | 3300020013 | Salt Marsh | RPVVKAGAKKRNDGNAATRNKAKTRLQKTGSIDDALSLILNQ |
| Ga0206125_102516091 | 3300020165 | Seawater | KAGAKRRQEGNSATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0211576_101726942 | 3300020438 | Marine | NGQKARPVVKPGAKKRQVGNNATRKKAQQRLQKTGSIDDALSLIINDS |
| Ga0206682_100503521 | 3300021185 | Seawater | VVKAGAKKRQDGNAATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0213867_10675151 | 3300021335 | Seawater | GAKKRRNPGKAAARKTAQTRLQKSGSINDALSLILDS |
| Ga0213865_101916671 | 3300021373 | Seawater | TKSNKARPVVKAGAKKRQDGNVATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0213861_103838162 | 3300021378 | Seawater | VRPVVKAGAKKRPDGQAATRKKAQQRLQKSGSIDDALSLMLKS |
| Ga0213861_105442481 | 3300021378 | Seawater | PVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| Ga0213866_101598551 | 3300021425 | Seawater | KQKSQSKADGARPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| Ga0213866_103663182 | 3300021425 | Seawater | RPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0196887_11092892 | 3300022178 | Aqueous | AKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| Ga0224502_103391351 | 3300022218 | Sediment | RPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| Ga0224501_104081271 | 3300022223 | Sediment | AKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0255779_11349402 | 3300022922 | Salt Marsh | GEKAMPMAKAGAKKRQDGNAVARKKAQQRLQKTGSIDDALNLLLKP |
| Ga0255783_102836452 | 3300022923 | Salt Marsh | ADGARPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIEDALSLMLKS |
| (restricted) Ga0233405_100307671 | 3300023114 | Seawater | PVVKAGAKKRVDSNAVTRKKAQARLQKTGSINDALSLILKQ |
| (restricted) Ga0233412_102306042 | 3300023210 | Seawater | GAKKRPDGQAATRKKAHQRLQKTGSIDDALSLMLKS |
| Ga0228695_10262002 | 3300023699 | Seawater | KGEKARPVVKAGVKKRKLTGVQAEQQKAQQRLMKTGSIDDALSLMLNND |
| Ga0228670_10201334 | 3300024319 | Seawater | NKARPVVKAGAKKRQDGNAATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0228652_10163886 | 3300024326 | Seawater | RPVVKAGAKKRQDGNAATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0228652_10225495 | 3300024326 | Seawater | VVKAGAKKRVDSNAATRKKAQQRLQKTGSMEDALSLILNQ |
| Ga0228652_11192292 | 3300024326 | Seawater | KATQTKGEKARPVVKAGVKKRKSTGVQAEQQKAQQRLMKTGSIDDALSLMLNND |
| Ga0228631_11423121 | 3300024329 | Seawater | IANKKKSQSKADGVRPVVKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0228672_11187942 | 3300024335 | Seawater | ADGVRPVVKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0209986_102723772 | 3300024433 | Deep Subsurface | PVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| (restricted) Ga0255044_103866862 | 3300024529 | Seawater | QQKGQKARPVVKAGAKKRQDGTGATRKKAQTRLQKTGSIDDAVNLIFNS |
| Ga0208791_10548961 | 3300025083 | Marine | PVVKAGAKKRPDGQAATRKKAHQRLQKTGSIDDALSLMLKS |
| Ga0208298_10201801 | 3300025084 | Marine | KSVQTKSNKARPVVKAGAKKRQDGNAATRKKAQERLQKTGSIDDALNLIISDS |
| Ga0208793_11427702 | 3300025108 | Marine | VKAGAKKAQDGQAATRKKAQTRLQKTGSIDDALGLILNS |
| Ga0208643_10210161 | 3300025645 | Aqueous | KGGKARPVVKAGTKKQKSSGVEVARNKAQQRLAKTGSIEDAISLMLNND |
| Ga0208795_10064571 | 3300025655 | Aqueous | GAKKRNDSNAATRNKAKTRLQKTGSIDDALSLILNQ |
| Ga0209251_11105011 | 3300025668 | Marine | KAGSRKVSDGQSATRKKARQRLQKTGSIKDAVGLILDN |
| Ga0208162_10047461 | 3300025674 | Aqueous | VKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0208899_11990092 | 3300025759 | Aqueous | GVRPVVKAGAKKRPDGQAATRKKAQQRLQKSGSIDDALSLMLKS |
| Ga0209137_12895031 | 3300025767 | Marine | AQSKGEKARPMVKSGAKKRQDSNVATRKKAQTRLQKTGSIDDALSLILNQ |
| Ga0208767_10761643 | 3300025769 | Aqueous | GEKARPVVKAGAKKRVDSNAVTRKKAQQRLQKTGSIDDALSLILKQ |
| Ga0208427_10623603 | 3300025771 | Aqueous | AKKRRNPGKAAARKTAQTRLQKSGSINDALSLILDS |
| Ga0208545_11471002 | 3300025806 | Aqueous | EKARPVIKAGAKKTADGNAATRKKAQTRLQKTGSIDDALGLIINS |
| Ga0208917_12290541 | 3300025840 | Aqueous | AKKRNDGNAATRNKAKTRLQKTGSIDDALSLILNQ |
| Ga0209308_103127031 | 3300025869 | Pelagic Marine | VKAGAKKRNDGNAATRNKAKTRLQKTGSIDDALSLILNQ |
| Ga0228644_10994442 | 3300026453 | Seawater | KADGVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0247602_10501081 | 3300026471 | Seawater | GAKKRVDSNAATRKKAQQRLQKTGSMEDALSLILNQ |
| Ga0228620_10132691 | 3300026483 | Seawater | ARPVVKAGAKKRQDGNAATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0247605_10492702 | 3300026503 | Seawater | GAKKRVDGNAATRKKAQTRLQKTGSIDDALSLILNQ |
| Ga0247590_11132382 | 3300026513 | Seawater | PVIKAGAKKTADGNAATRKKAKTRLQKTGSIDDALGLIINS |
| Ga0208963_10613531 | 3300027170 | Marine | VKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0208970_10767791 | 3300027298 | Marine | RSQSKADGVRPVVKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0209815_11974941 | 3300027714 | Marine | TQSKGEKARPMVKAGAKKRQDGVATTRKKAQARLQKTGSIEDALSLILKQ |
| Ga0209092_106382111 | 3300027833 | Marine | GAKKRQDGNAANRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0228634_10750052 | 3300028129 | Seawater | KSNKARPVVKAGAKKRQDGNAATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0228608_10808272 | 3300028136 | Seawater | VRPVVKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0228627_11138192 | 3300028414 | Seawater | RQLIANKKKSQSKADGVRPVVKAGAKKRSDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0228625_10081931 | 3300028419 | Seawater | SNKARPVVKAGAKKRQDGNVATRKKAQQRLQKTGSIDDALNLIIGDS |
| Ga0307998_10453371 | 3300031702 | Marine | QQKGQNARPVVKAGAKKTADSKANTRKKAQQRLQKSGSINDALSLMLNS |
| Ga0316205_102186091 | 3300032257 | Microbial Mat | SKADGVRPVVKAGAKKRPDGQAATRKKAQQRLQKTGSIDDALSLMLKS |
| Ga0316203_11874011 | 3300032274 | Microbial Mat | VKAGAKKRPDGQAATRKKAHQRLQKTGSIDDALSLMLKS |
| Ga0316202_103337691 | 3300032277 | Microbial Mat | AGAKKRRNPGKAAARKTAQTRLQKSGSINDALNLILDS |
| Ga0314858_066975_14_136 | 3300033742 | Sea-Ice Brine | VVKAGAKKRQDGNAVTRKKAQTRLQKTGSDADALSLMFKQ |
| Ga0314858_093126_617_739 | 3300033742 | Sea-Ice Brine | MVKAGAKKRPDSNADTRKKAQTRLQKTGSDADALSLMFKQ |
| ⦗Top⦘ |