| Basic Information | |
|---|---|
| Family ID | F090610 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MHKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 37.96 % |
| % of genes near scaffold ends (potentially truncated) | 23.15 % |
| % of genes from short scaffolds (< 2000 bps) | 69.44 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (62.963 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.741 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 66.67% β-sheet: 0.00% Coil/Unstructured: 33.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 4.63 |
| PF02867 | Ribonuc_red_lgC | 3.70 |
| PF00118 | Cpn60_TCP1 | 2.78 |
| PF01068 | DNA_ligase_A_M | 2.78 |
| PF00268 | Ribonuc_red_sm | 1.85 |
| PF08291 | Peptidase_M15_3 | 0.93 |
| PF13662 | Toprim_4 | 0.93 |
| PF02954 | HTH_8 | 0.93 |
| PF00166 | Cpn10 | 0.93 |
| PF00303 | Thymidylat_synt | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 3.70 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.78 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.78 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.78 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.85 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.93 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.81 % |
| Unclassified | root | N/A | 35.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001344|JGI20152J14361_10055611 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1003 | Open in IMG/M |
| 3300001450|JGI24006J15134_10032854 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2258 | Open in IMG/M |
| 3300005404|Ga0066856_10021999 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2764 | Open in IMG/M |
| 3300005432|Ga0066845_10085049 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1190 | Open in IMG/M |
| 3300005522|Ga0066861_10249096 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 605 | Open in IMG/M |
| 3300005731|Ga0076919_1000471 | Not Available | 14325 | Open in IMG/M |
| 3300005837|Ga0078893_10046801 | Not Available | 34986 | Open in IMG/M |
| 3300005837|Ga0078893_10284282 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 728 | Open in IMG/M |
| 3300006193|Ga0075445_10128389 | Not Available | 924 | Open in IMG/M |
| 3300006735|Ga0098038_1062269 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1332 | Open in IMG/M |
| 3300006735|Ga0098038_1115077 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 918 | Open in IMG/M |
| 3300006735|Ga0098038_1165244 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 730 | Open in IMG/M |
| 3300006737|Ga0098037_1305452 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 502 | Open in IMG/M |
| 3300006749|Ga0098042_1116967 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 667 | Open in IMG/M |
| 3300006793|Ga0098055_1275864 | Not Available | 630 | Open in IMG/M |
| 3300006916|Ga0070750_10003593 | Not Available | 8577 | Open in IMG/M |
| 3300006916|Ga0070750_10050980 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2005 | Open in IMG/M |
| 3300006920|Ga0070748_1174381 | Not Available | 793 | Open in IMG/M |
| 3300006921|Ga0098060_1193001 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 557 | Open in IMG/M |
| 3300006921|Ga0098060_1228810 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 505 | Open in IMG/M |
| 3300007539|Ga0099849_1035066 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2132 | Open in IMG/M |
| 3300007539|Ga0099849_1212429 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 724 | Open in IMG/M |
| 3300007555|Ga0102817_1014633 | All Organisms → Viruses → Predicted Viral | 1758 | Open in IMG/M |
| 3300007863|Ga0105744_1050740 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1024 | Open in IMG/M |
| 3300007863|Ga0105744_1060629 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 932 | Open in IMG/M |
| 3300007992|Ga0105748_10169005 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 901 | Open in IMG/M |
| 3300008470|Ga0115371_10972026 | Not Available | 532 | Open in IMG/M |
| 3300009434|Ga0115562_1036189 | Not Available | 2326 | Open in IMG/M |
| 3300009593|Ga0115011_10734115 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 811 | Open in IMG/M |
| 3300009790|Ga0115012_10240986 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1341 | Open in IMG/M |
| 3300009790|Ga0115012_10574322 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 890 | Open in IMG/M |
| 3300010148|Ga0098043_1069717 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1053 | Open in IMG/M |
| 3300010296|Ga0129348_1032179 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1908 | Open in IMG/M |
| 3300010297|Ga0129345_1010410 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3622 | Open in IMG/M |
| 3300010318|Ga0136656_1087185 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1101 | Open in IMG/M |
| 3300012919|Ga0160422_10001103 | Not Available | 16722 | Open in IMG/M |
| 3300012919|Ga0160422_10033520 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2975 | Open in IMG/M |
| 3300012919|Ga0160422_10276127 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1030 | Open in IMG/M |
| 3300012919|Ga0160422_11164153 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 501 | Open in IMG/M |
| 3300012920|Ga0160423_10249278 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1229 | Open in IMG/M |
| 3300012920|Ga0160423_10564286 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 772 | Open in IMG/M |
| 3300012920|Ga0160423_10614924 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 736 | Open in IMG/M |
| 3300012936|Ga0163109_10361570 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1062 | Open in IMG/M |
| 3300012952|Ga0163180_11504461 | Not Available | 563 | Open in IMG/M |
| 3300012953|Ga0163179_10107397 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2027 | Open in IMG/M |
| 3300012953|Ga0163179_10612971 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 914 | Open in IMG/M |
| 3300012953|Ga0163179_10776526 | Not Available | 819 | Open in IMG/M |
| 3300012953|Ga0163179_10793713 | Not Available | 811 | Open in IMG/M |
| 3300017710|Ga0181403_1033440 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1084 | Open in IMG/M |
| 3300017719|Ga0181390_1004054 | Not Available | 5768 | Open in IMG/M |
| 3300017742|Ga0181399_1064011 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 941 | Open in IMG/M |
| 3300017750|Ga0181405_1116287 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 669 | Open in IMG/M |
| 3300017750|Ga0181405_1126785 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 636 | Open in IMG/M |
| 3300017756|Ga0181382_1199531 | Not Available | 506 | Open in IMG/M |
| 3300017767|Ga0181406_1154433 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 688 | Open in IMG/M |
| 3300017771|Ga0181425_1034015 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1678 | Open in IMG/M |
| 3300017786|Ga0181424_10052332 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1768 | Open in IMG/M |
| 3300018642|Ga0188867_1005044 | Not Available | 656 | Open in IMG/M |
| 3300019459|Ga0181562_10024395 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3911 | Open in IMG/M |
| 3300020185|Ga0206131_10330564 | Not Available | 667 | Open in IMG/M |
| 3300020282|Ga0211667_1000016 | Not Available | 64289 | Open in IMG/M |
| 3300020306|Ga0211616_1027246 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 860 | Open in IMG/M |
| 3300020349|Ga0211511_1157593 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 505 | Open in IMG/M |
| 3300020382|Ga0211686_10011623 | Not Available | 3821 | Open in IMG/M |
| 3300020388|Ga0211678_10002955 | Not Available | 11964 | Open in IMG/M |
| 3300020408|Ga0211651_10010129 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4961 | Open in IMG/M |
| 3300020413|Ga0211516_10065007 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1803 | Open in IMG/M |
| 3300020413|Ga0211516_10149056 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300020413|Ga0211516_10441467 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 574 | Open in IMG/M |
| 3300020419|Ga0211512_10342021 | Not Available | 677 | Open in IMG/M |
| 3300020438|Ga0211576_10000677 | Not Available | 28146 | Open in IMG/M |
| 3300020446|Ga0211574_10229638 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 805 | Open in IMG/M |
| 3300020450|Ga0211641_10170272 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1094 | Open in IMG/M |
| 3300020463|Ga0211676_10000164 | Not Available | 68037 | Open in IMG/M |
| 3300020463|Ga0211676_10119355 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1705 | Open in IMG/M |
| 3300020471|Ga0211614_10000873 | Not Available | 13405 | Open in IMG/M |
| 3300020474|Ga0211547_10018399 | Not Available | 3938 | Open in IMG/M |
| 3300020595|Ga0206126_10002233 | Not Available | 21571 | Open in IMG/M |
| 3300021085|Ga0206677_10002319 | Not Available | 16873 | Open in IMG/M |
| 3300021185|Ga0206682_10006845 | Not Available | 8645 | Open in IMG/M |
| 3300021347|Ga0213862_10143873 | Not Available | 838 | Open in IMG/M |
| 3300021373|Ga0213865_10452855 | Not Available | 558 | Open in IMG/M |
| 3300021375|Ga0213869_10001137 | Not Available | 20534 | Open in IMG/M |
| 3300021960|Ga0222715_10260930 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1003 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10239584 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 875 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10077816 | Not Available | 1050 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10190940 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 887 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10163888 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 707 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10240688 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 721 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10249537 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 713 | Open in IMG/M |
| 3300025086|Ga0208157_1129112 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 578 | Open in IMG/M |
| 3300025120|Ga0209535_1053815 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1694 | Open in IMG/M |
| 3300025132|Ga0209232_1225978 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 556 | Open in IMG/M |
| 3300025617|Ga0209138_1012054 | Not Available | 4492 | Open in IMG/M |
| 3300025636|Ga0209136_1087577 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 929 | Open in IMG/M |
| 3300025654|Ga0209196_1136778 | Not Available | 687 | Open in IMG/M |
| 3300025674|Ga0208162_1174460 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 568 | Open in IMG/M |
| 3300025696|Ga0209532_1008168 | Not Available | 5877 | Open in IMG/M |
| 3300025816|Ga0209193_1151867 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 536 | Open in IMG/M |
| 3300026136|Ga0208763_1000218 | Not Available | 12497 | Open in IMG/M |
| 3300026292|Ga0208277_1016011 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3692 | Open in IMG/M |
| 3300027742|Ga0209121_10309719 | Not Available | 510 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10056650 | Not Available | 1227 | Open in IMG/M |
| 3300027906|Ga0209404_10000183 | Not Available | 53662 | Open in IMG/M |
| 3300027906|Ga0209404_10046160 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2455 | Open in IMG/M |
| 3300027906|Ga0209404_10780992 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 648 | Open in IMG/M |
| 3300029448|Ga0183755_1017418 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2499 | Open in IMG/M |
| 3300032257|Ga0316205_10293885 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 572 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.22% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.59% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.19% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.56% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 4.63% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.63% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.70% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 3.70% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.78% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.78% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.78% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.93% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.93% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.93% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.93% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020306 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX556014-ERR599098) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20152J14361_100556112 | 3300001344 | Pelagic Marine | MKMHKVWRLYIIDNKSITEISKELNITKNKLKLKYGLK* |
| JGI24006J15134_100328548 | 3300001450 | Marine | MHKVWRLYLLDNKSITEISKQLNITKNKLKIQYGLK* |
| Ga0066856_100219995 | 3300005404 | Marine | MMKWKSKMKMHKVWRLYLINNKSITEISKELNITKNKLKTQYGLK* |
| Ga0066845_100850493 | 3300005432 | Marine | MMKWKSKMKMHKVWRLYLINNKSITEISKELNITKSKLKLKYGLK* |
| Ga0066861_102490962 | 3300005522 | Marine | MKMHKVWRLYLINNKSITEISKELNITKSKLKLKYGLK* |
| Ga0076919_10004717 | 3300005731 | M | MHKVWRLYIIDNKSITEISKQLNITKNKLKTQYGLK* |
| Ga0078893_1004680142 | 3300005837 | Marine Surface Water | MPGREAEHNVWRLYIADNKSITEISKLLNITKSKLKNTYGLK* |
| Ga0078893_102842823 | 3300005837 | Marine Surface Water | MHKVWRLYIIDNKSITEISKELNITKNKLKLKYGLK* |
| Ga0075445_101283891 | 3300006193 | Marine | NEPWRLYLLDNKSLTEISKMLNITKNKLINEYGLK* |
| Ga0098038_10622696 | 3300006735 | Marine | MHKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK* |
| Ga0098038_11150771 | 3300006735 | Marine | KKQMHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK* |
| Ga0098038_11652444 | 3300006735 | Marine | MMK*NYKNKKQMHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK* |
| Ga0098037_13054521 | 3300006737 | Marine | MHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK* |
| Ga0098042_11169671 | 3300006749 | Marine | KKQMHKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK* |
| Ga0098055_12758643 | 3300006793 | Marine | MHKAWRLYLLDNKSLTEISKLLNVSKNKLKTQYGLK* |
| Ga0070750_1000359327 | 3300006916 | Aqueous | MHKVWRLYLLNNKSITEISKELNITKSKLKTQYGLK* |
| Ga0070750_100509802 | 3300006916 | Aqueous | MHKVWRLYLIDNKSITEISKQLNITKNKLKVQYGLK* |
| Ga0070748_11743812 | 3300006920 | Aqueous | MNKPWRLYLIDNKSLTEISKMLNITKSKLKNEYGLK* |
| Ga0098060_11930011 | 3300006921 | Marine | MMK*NYKNKKQMHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK*I |
| Ga0098060_12288103 | 3300006921 | Marine | KQMHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK* |
| Ga0099849_10350665 | 3300007539 | Aqueous | MNKVWRLYLIDNKSITEISKELNITKNKLKVQYGLK* |
| Ga0099849_12124292 | 3300007539 | Aqueous | MHKVWRLYLIDNKSISEISKQLNITKNKLKVQYGLK* |
| Ga0102817_10146332 | 3300007555 | Estuarine | MHKAWRLYLLDNKSLTEISKLLNITKNKLKTQYGLK* |
| Ga0105744_10507405 | 3300007863 | Estuary Water | MKMHKVWRLYIIDNKSISEISKQLNITKNKLKVQYGLK* |
| Ga0105744_10606293 | 3300007863 | Estuary Water | MHKVWRLYLIDNKSITEISKKLNITKSKLKIQYGLK* |
| Ga0105748_101690053 | 3300007992 | Estuary Water | MHKVWRLYLIDNKSITEISKKLNITKSKLKTQYGLK* |
| Ga0115371_109720262 | 3300008470 | Sediment | MHKAWRLYLLDNKSLTEISKMLNITKNKLINEYGLK |
| Ga0115562_10361898 | 3300009434 | Pelagic Marine | MHKTWRLYLLDNKSLTEISKLLNVSKNKLKTQYGLK* |
| Ga0115011_107341152 | 3300009593 | Marine | MHKVWRLYLINNKSITEISKELNITKNKLKLKYGLK* |
| Ga0115012_102409863 | 3300009790 | Marine | MHKIWRLYLIDNKSITEISKELNITKSKLKLKYGLK* |
| Ga0115012_105743224 | 3300009790 | Marine | MHKVWRLYLIDNKSITEISKELNITKSKLQTQYGIK* |
| Ga0098043_10697173 | 3300010148 | Marine | MKLRIDKVWRLYLLDNKSITEISKELNITKSKLKLKYGLK* |
| Ga0129348_10321793 | 3300010296 | Freshwater To Marine Saline Gradient | MHKVWRLYLIDNKSITEISKKLNITKNKLKLKYGLK* |
| Ga0129345_10104104 | 3300010297 | Freshwater To Marine Saline Gradient | MHKVWRLYLIDNKSITEISKELNITKNKLKVQYGLK* |
| Ga0136656_10871853 | 3300010318 | Freshwater To Marine Saline Gradient | MNKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK* |
| Ga0160422_100011038 | 3300012919 | Seawater | MKMHKVWRLYLIDNKSITQISKELNITKNKLKLKYGLK* |
| Ga0160422_1003352011 | 3300012919 | Seawater | MKMHKVWRLYLIDNKSITQISKELNITKSKLKTQYGLK* |
| Ga0160422_102761275 | 3300012919 | Seawater | MHKVWRLYLINNKSITEISKELNITKSKLKLKYGLK* |
| Ga0160422_111641532 | 3300012919 | Seawater | MKMHKVWRLYLLDNKSITQISKELNITKSKLKLKYGLK* |
| Ga0160423_102492782 | 3300012920 | Surface Seawater | MKMHKVWRLYLLNNKSITEISKELNITKSKLKLKYGLK* |
| Ga0160423_105642861 | 3300012920 | Surface Seawater | MNKVWRLYLLDNKSITEISKELNITKSKLKLKYGLK |
| Ga0160423_106149241 | 3300012920 | Surface Seawater | KVWRLYLLDNKSITQISKELNITKSKLKTQYGLK* |
| Ga0163109_103615705 | 3300012936 | Surface Seawater | MHKVWRLYLIDNKSITEISKELNITKSKLKLKYGLK* |
| Ga0163180_115044611 | 3300012952 | Seawater | MFNRVWRLYLVNKKSNTQISEQLNKTKSKKEIKYGIK* |
| Ga0163179_101073977 | 3300012953 | Seawater | MKMHKVWRLYLLDNKSITEISKELNITKNKLKVQYGLK* |
| Ga0163179_106129712 | 3300012953 | Seawater | MKLRIDKVWRLYLLDNKSITEISKELNITKSKLKVQYGLK* |
| Ga0163179_107765264 | 3300012953 | Seawater | MFNRVWRLYLVNNKSITEISEQLNITKSKLKIKYGIK* |
| Ga0163179_107937134 | 3300012953 | Seawater | MFNRVWRLYLVNNKSITEISEQLNITKSKLKIKYGLK* |
| Ga0181403_10334401 | 3300017710 | Seawater | WRLYLINNKSITEISKELNITKNKLKLKYGLKXET |
| Ga0181390_10040543 | 3300017719 | Seawater | MKMHKVWRLYIIDNKSITEISKQLNITKNKLKLKYGLK |
| Ga0181399_10640111 | 3300017742 | Seawater | HKMKMHKVWRLYIIDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0181405_11162875 | 3300017750 | Seawater | KNKKQMHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0181405_11267851 | 3300017750 | Seawater | HKVWRLYLLDNKSITEISKELNITKSKLKLKYGLK |
| Ga0181382_11995311 | 3300017756 | Seawater | LYLLDNKSLTEISKLLNITKNKLKTQYGLKXIQLKK |
| Ga0181406_11544334 | 3300017767 | Seawater | MHKVWRLYLINNKSITEISKQLNITKNKLKTQYGLK |
| Ga0181425_10340154 | 3300017771 | Seawater | MKMHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0181424_100523323 | 3300017786 | Seawater | MHKVWRLYLLDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0188867_10050443 | 3300018642 | Freshwater Lake | MHRAWRLYLLDNKSLTEISKLLNVSKNKLKTQHGLK |
| Ga0181562_1002439514 | 3300019459 | Salt Marsh | MHKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK |
| Ga0206131_103305642 | 3300020185 | Seawater | MAEPWRLYLLDNKSLTEISNILNITKSKLKNEYGLK |
| Ga0211667_100001644 | 3300020282 | Marine | MHKVWRLYLIDNKSITEISKELNITKSKLKLKYGLK |
| Ga0211616_10272463 | 3300020306 | Marine | MKMHKVWRLYLIDNKSITQISKELNITKSKLKLKYGLK |
| Ga0211511_11575931 | 3300020349 | Marine | MHKVWRLYLLDNKSITEISKELNITKSKLKIQYGLK |
| Ga0211686_100116239 | 3300020382 | Marine | MNEPWRLYLLDNKSLTEISKMLNITKNKLINEYGLK |
| Ga0211678_1000295533 | 3300020388 | Marine | KKQKQMHKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK |
| Ga0211651_100101299 | 3300020408 | Marine | MKMHKVWRLYLLDNKSITEISKELNITKSKLKLKYGLK |
| Ga0211516_100650072 | 3300020413 | Marine | MHKVWRLYLIDNKSITEISKELNITKSKLKIQYGLK |
| Ga0211516_101490566 | 3300020413 | Marine | MFNRVWRLYLVNNKSITEISEQLNITKSKLKIKYGIK |
| Ga0211516_104414673 | 3300020413 | Marine | MKMHKVWRLYLLDNKSITEISKELNITKNKLKVQYGLK |
| Ga0211512_103420213 | 3300020419 | Marine | MFNRVWRLYLVNNKSITEISEQLNITKSKLKIKYGLK |
| Ga0211576_1000067737 | 3300020438 | Marine | MHKVWRLYLIDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0211574_102296382 | 3300020446 | Marine | MKMHKVWRLYLINNKSITEISKELNITKSKLKLKYGLK |
| Ga0211641_101702725 | 3300020450 | Marine | MKMHKIWRLYLLDNKSITEISKELNITKSKLKLKYGLK |
| Ga0211676_1000016433 | 3300020463 | Marine | MKLKMHKVWRLYLLDNKSITEISKELNITKNKLKLKYGLK |
| Ga0211676_101193555 | 3300020463 | Marine | MHKVWRLYIIDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0211614_1000087327 | 3300020471 | Marine | MDKVWTNKVWKAYMIHNKSVTEISKEFNITKNKLKTKYGIW |
| Ga0211547_1001839914 | 3300020474 | Marine | MMFNRVWRLYLVNNKSITEISEQLNITKSKLKIKYGIK |
| Ga0206126_1000223334 | 3300020595 | Seawater | MHKTWRLYLLDNKSLTEISKLLNVSKNKLKTQYGLK |
| Ga0206677_100023192 | 3300021085 | Seawater | MHKAWRLYLLDNKSLTEISKLLNITKNKLKTQYGLK |
| Ga0206682_1000684520 | 3300021185 | Seawater | MKMHKVWRLYIIDNKSITEISKQLNITKNKLKTQYGLK |
| Ga0213862_101438732 | 3300021347 | Seawater | MNKPWRLYLIDNKSLTEISKMLNITKSKLKNEYGLK |
| Ga0213865_104528554 | 3300021373 | Seawater | SKNLPKMHKAWRLYLLDNKSLTEISKLLNVSKNKLKTQYGLK |
| Ga0213869_1000113737 | 3300021375 | Seawater | MHKVWRLYLIDNKSITEISKQLNITKNKLKVQYGLK |
| Ga0222715_102609306 | 3300021960 | Estuarine Water | MHEVWRLYIIDNKSITEISKELNITKNKLKLKYGLK |
| (restricted) Ga0233432_102395843 | 3300023109 | Seawater | MKMHKVWRLYLIDNKSITEISKQLNITKNKLKVQYGLK |
| (restricted) Ga0233411_100778166 | 3300023112 | Seawater | MHKVWRLYIIDNKSISEISKQLNITKNKLKVQYGLK |
| (restricted) Ga0233412_101909401 | 3300023210 | Seawater | HKMKMHKVWRLYLIDNKSITEISKQLNITKNKLKVQYGLK |
| (restricted) Ga0233410_101638884 | 3300023276 | Seawater | MKMHKVWRLYIIDNKSISEISKQLNITKNKLKTQYGLK |
| (restricted) Ga0233438_102406884 | 3300024255 | Seawater | MIKXNYKKKKQMHKVWRLYLIDNKSITEISKQLNITKNKLKIKYGL |
| (restricted) Ga0255044_102495372 | 3300024529 | Seawater | MHKVWRLYLIDNKSISEISKQLNITKNKLKVQYGLK |
| Ga0208157_11291123 | 3300025086 | Marine | MHKVWRLYIIDNKSITEISKELNITKNKLKLKYGLK |
| Ga0209535_10538155 | 3300025120 | Marine | MHKVWRLYLLDNKSITEISKQLNITKNKLKIQYGLK |
| Ga0209232_12259781 | 3300025132 | Marine | MHKVWRLYLINNKSITEISKELNITKSKLKTQYGLK |
| Ga0209138_10120549 | 3300025617 | Marine | MNLKHLLMNKPWRLYLIDNKSLTEISKMLNITKSKLKNEYGLK |
| Ga0209136_10875772 | 3300025636 | Marine | MKMHKVWRLYIIDNKSISEISKQLNITKNKLKVQYGLK |
| Ga0209196_11367784 | 3300025654 | Pelagic Marine | KNLQKMHKTWRLYLLDNKSLTEISKLLNVSKNKLKTQYGLK |
| Ga0208162_11744602 | 3300025674 | Aqueous | MNKVWRLYLIDNKSITEISKELNITKNKLKVQYGLK |
| Ga0209532_100816814 | 3300025696 | Pelagic Marine | MKMHKVWRLYIIDNKSITEISKELNITKNKLKLKYGLK |
| Ga0209193_11518671 | 3300025816 | Pelagic Marine | MKMHKVWRLYIIDNKSITEISKELNITKNKLKLKYG |
| Ga0208763_100021833 | 3300026136 | Marine | MMKWKSKMKMHKVWRLYLINNKSITEISKELNITKSKLKLKYGLK |
| Ga0208277_10160119 | 3300026292 | Marine | MMKWKSKMKMHKVWRLYLINNKSITEISKELNITKNKLKTQYGLK |
| Ga0209121_103097191 | 3300027742 | Marine | KSLQKMHKAWRLYLLDNKSLTEISKLLNITKNKLKTQYGLK |
| (restricted) Ga0255041_100566506 | 3300027837 | Seawater | QEPERNVWRLYLIDNKSLSEISKLLNVTKSKLKNTYGIK |
| Ga0209404_100001836 | 3300027906 | Marine | MHKVWRLYLINNKSITEISKELNITKNKLKLKYGLK |
| Ga0209404_100461607 | 3300027906 | Marine | MHKVWRLYLIDNKSITEISKELNITKSKLQTQYGIK |
| Ga0209404_107809923 | 3300027906 | Marine | MHKVWRLYLLNNKSITEISKELNITKSKLKTQYGLK |
| Ga0183755_10174189 | 3300029448 | Marine | MKMHKVWRLYLLDNKSITEISKELNITKSKLKIQYGLK |
| Ga0316205_102938851 | 3300032257 | Microbial Mat | YKKKKQMHKVWRLYLIDNKSITEISKELNITKNKLKLKYGLK |
| ⦗Top⦘ |