Metagenome Family F090585

Basic Information
Family ID	F090585
Family Type	Metagenome
Number of Sequences	108
Average Sequence Length	37 residues
Representative Sequence	MDPYYKKMMLWLAAAFVASIVAAVIIVELVIRKYGP
Number of Associated Samples	93
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	30.56 %
% of genes near scaffold ends (potentially truncated)	12.04 %
% of genes from short scaffolds (< 2000 bps)	85.19 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Most Common Taxonomy
Group	Bacteria (97.222 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members)
Environment Ontology (ENVO)	Unclassified (37.037 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (48.148 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF05193	Peptidase_M16_C	25.93
PF00474	SSF	25.93
PF00072	Response_reg	6.48
PF01145	Band_7	1.85
PF02410	RsfS	0.93
PF02439	Adeno_E3_CR2	0.93
PF03847	TFIID_20kDa	0.93
PF03544	TonB_C	0.93
PF00271	Helicase_C	0.93
PF13540	RCC1_2	0.93
PF01841	Transglut_core	0.93
PF00350	Dynamin_N	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG0799	Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits	Translation, ribosomal structure and biogenesis [J]	0.93
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.93

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.22 %
Unclassified	root	N/A	2.78 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.22 %
Unclassified	root	N/A	2.78 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.22 %
Unclassified	root	N/A	2.78 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	64.81 %
Unclassified	root	N/A	2.78 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.93 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	16.67 %
Unclassified	root	N/A	2.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.85 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	16.67 %
Unclassified	root	N/A	2.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.85 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	0.93 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	16.67 %
Unclassified	root	N/A	2.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.85 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	0.93 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	16.67 %
Unclassified	root	N/A	2.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.85 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	0.93 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	16.67 %
Unclassified	root	N/A	2.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.85 %
unclassified Luteitalea	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea	0.93 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	16.67 %
Unclassified	root	N/A	2.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.85 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.93 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2140918006\|ConsensusfromContig37427	All Organisms → cellular organisms → Bacteria	2316	Open in IMG/M
2170459019\|G14TP7Y02I41RS	All Organisms → cellular organisms → Bacteria → Acidobacteria	523	Open in IMG/M
2199352024\|deeps__Contig_152722	All Organisms → cellular organisms → Bacteria → Acidobacteria	628	Open in IMG/M
3300000956\|JGI10216J12902_103112716	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	784	Open in IMG/M
3300000956\|JGI10216J12902_103398788	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M
3300000956\|JGI10216J12902_103749502	All Organisms → cellular organisms → Bacteria → Acidobacteria	1212	Open in IMG/M
3300000956\|JGI10216J12902_119093050	All Organisms → cellular organisms → Bacteria → Acidobacteria	2094	Open in IMG/M
3300000956\|JGI10216J12902_125599917	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1277	Open in IMG/M
3300005293\|Ga0065715_10037791	All Organisms → cellular organisms → Bacteria → Acidobacteria	1160	Open in IMG/M
3300005332\|Ga0066388_104965712	Not Available	676	Open in IMG/M
3300005543\|Ga0070672_100025062	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	4418	Open in IMG/M
3300005617\|Ga0068859_100228907	All Organisms → cellular organisms → Bacteria → Acidobacteria	1947	Open in IMG/M
3300005713\|Ga0066905_100634068	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	909	Open in IMG/M
3300005764\|Ga0066903_100021343	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	6918	Open in IMG/M
3300005980\|Ga0066798_10140115	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300006031\|Ga0066651_10694702	All Organisms → cellular organisms → Bacteria → Acidobacteria	546	Open in IMG/M
3300006196\|Ga0075422_10485916	All Organisms → cellular organisms → Bacteria → Acidobacteria	558	Open in IMG/M
3300006196\|Ga0075422_10552042	All Organisms → cellular organisms → Bacteria → Acidobacteria	528	Open in IMG/M
3300006755\|Ga0079222_10439192	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300006791\|Ga0066653_10738866	All Organisms → cellular organisms → Bacteria → Acidobacteria	512	Open in IMG/M
3300006800\|Ga0066660_10888026	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	726	Open in IMG/M
3300006845\|Ga0075421_100723642	All Organisms → cellular organisms → Bacteria	1154	Open in IMG/M
3300006853\|Ga0075420_101536285	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300006880\|Ga0075429_101376410	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300006880\|Ga0075429_101715358	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300007004\|Ga0079218_11041588	All Organisms → cellular organisms → Bacteria → Acidobacteria	826	Open in IMG/M
3300007004\|Ga0079218_13382512	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300007076\|Ga0075435_101636527	All Organisms → cellular organisms → Bacteria → Acidobacteria	565	Open in IMG/M
3300007255\|Ga0099791_10307867	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300009029\|Ga0066793_10595206	All Organisms → cellular organisms → Bacteria → Acidobacteria	630	Open in IMG/M
3300009088\|Ga0099830_10889627	All Organisms → cellular organisms → Bacteria → Acidobacteria	736	Open in IMG/M
3300009094\|Ga0111539_10217497	All Organisms → cellular organisms → Bacteria → Acidobacteria	2225	Open in IMG/M
3300009094\|Ga0111539_10506328	All Organisms → cellular organisms → Bacteria → Acidobacteria	1406	Open in IMG/M
3300009094\|Ga0111539_11965225	All Organisms → cellular organisms → Bacteria → Acidobacteria	678	Open in IMG/M
3300009148\|Ga0105243_11407363	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	718	Open in IMG/M
3300009156\|Ga0111538_11954292	All Organisms → cellular organisms → Bacteria → Acidobacteria	738	Open in IMG/M
3300009162\|Ga0075423_10359222	All Organisms → cellular organisms → Bacteria	1528	Open in IMG/M
3300009553\|Ga0105249_11531531	All Organisms → cellular organisms → Bacteria → Acidobacteria	739	Open in IMG/M
3300009610\|Ga0105340_1108562	All Organisms → cellular organisms → Bacteria	1119	Open in IMG/M
3300009789\|Ga0126307_10153751	All Organisms → cellular organisms → Bacteria	1842	Open in IMG/M
3300009789\|Ga0126307_10572094	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300010046\|Ga0126384_10650553	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	928	Open in IMG/M
3300010362\|Ga0126377_10054049	All Organisms → cellular organisms → Bacteria	3513	Open in IMG/M
3300010397\|Ga0134124_10766929	All Organisms → cellular organisms → Bacteria	961	Open in IMG/M
3300011269\|Ga0137392_11239322	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300011398\|Ga0137348_1084544	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300011424\|Ga0137439_1076733	All Organisms → cellular organisms → Bacteria → Acidobacteria	696	Open in IMG/M
3300011432\|Ga0137428_1113176	All Organisms → cellular organisms → Bacteria → Acidobacteria	779	Open in IMG/M
3300012092\|Ga0136621_1062834	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1521	Open in IMG/M
3300012204\|Ga0137374_10067037	All Organisms → cellular organisms → Bacteria	3558	Open in IMG/M
3300012204\|Ga0137374_10525477	All Organisms → cellular organisms → Bacteria → Acidobacteria	914	Open in IMG/M
3300012208\|Ga0137376_11456503	All Organisms → cellular organisms → Bacteria → Acidobacteria	576	Open in IMG/M
3300012210\|Ga0137378_11781058	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300012212\|Ga0150985_106055467	All Organisms → cellular organisms → Bacteria	2495	Open in IMG/M
3300012228\|Ga0137459_1017584	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1992	Open in IMG/M
3300012350\|Ga0137372_10872537	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	641	Open in IMG/M
3300012680\|Ga0136612_10041752	All Organisms → cellular organisms → Bacteria	2304	Open in IMG/M
3300012684\|Ga0136614_10192724	All Organisms → cellular organisms → Bacteria	1537	Open in IMG/M
3300012892\|Ga0157294_10027459	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1163	Open in IMG/M
3300012895\|Ga0157309_10173990	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	657	Open in IMG/M
3300012909\|Ga0157290_10200196	All Organisms → cellular organisms → Bacteria → Acidobacteria	678	Open in IMG/M
3300012916\|Ga0157310_10568465	All Organisms → cellular organisms → Bacteria → Acidobacteria	506	Open in IMG/M
3300013765\|Ga0120172_1066330	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300014326\|Ga0157380_12639266	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300015197\|Ga0167638_1076321	All Organisms → cellular organisms → Bacteria → Acidobacteria	680	Open in IMG/M
3300015251\|Ga0180070_1016504	All Organisms → cellular organisms → Bacteria → Acidobacteria	841	Open in IMG/M
3300015371\|Ga0132258_11085769	All Organisms → cellular organisms → Bacteria	2023	Open in IMG/M
3300015372\|Ga0132256_102471591	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	621	Open in IMG/M
3300015372\|Ga0132256_102546686	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300017965\|Ga0190266_10128306	All Organisms → cellular organisms → Bacteria → Acidobacteria	1099	Open in IMG/M
3300018073\|Ga0184624_10024303	All Organisms → cellular organisms → Bacteria	2291	Open in IMG/M
3300018084\|Ga0184629_10213128	All Organisms → cellular organisms → Bacteria → Acidobacteria	1001	Open in IMG/M
3300018429\|Ga0190272_13162692	All Organisms → cellular organisms → Bacteria → Acidobacteria	512	Open in IMG/M
3300018432\|Ga0190275_10373438	All Organisms → cellular organisms → Bacteria	1427	Open in IMG/M
3300018432\|Ga0190275_12480167	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596	Open in IMG/M
3300018469\|Ga0190270_10026963	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3672	Open in IMG/M
3300018476\|Ga0190274_13707245	All Organisms → cellular organisms → Bacteria → Acidobacteria	517	Open in IMG/M
3300018481\|Ga0190271_10419800	All Organisms → cellular organisms → Bacteria → Acidobacteria	1436	Open in IMG/M
3300018481\|Ga0190271_11174552	Not Available	890	Open in IMG/M
3300019361\|Ga0173482_10146674	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	914	Open in IMG/M
3300019868\|Ga0193720_1013425	All Organisms → cellular organisms → Bacteria	1145	Open in IMG/M
3300020009\|Ga0193740_1018927	All Organisms → cellular organisms → Bacteria	1091	Open in IMG/M
3300021082\|Ga0210380_10331877	All Organisms → cellular organisms → Bacteria → Acidobacteria	694	Open in IMG/M
3300022756\|Ga0222622_10157394	All Organisms → cellular organisms → Bacteria	1471	Open in IMG/M
3300025315\|Ga0207697_10016284	All Organisms → cellular organisms → Bacteria → Acidobacteria	3062	Open in IMG/M
3300025321\|Ga0207656_10291354	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	807	Open in IMG/M
3300025893\|Ga0207682_10094861	All Organisms → cellular organisms → Bacteria → Acidobacteria	1298	Open in IMG/M
3300025905\|Ga0207685_10158874	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	1030	Open in IMG/M
3300025910\|Ga0207684_10668017	All Organisms → cellular organisms → Bacteria → Acidobacteria	884	Open in IMG/M
3300025923\|Ga0207681_11224058	All Organisms → cellular organisms → Bacteria → Acidobacteria	631	Open in IMG/M
3300025937\|Ga0207669_11707805	All Organisms → cellular organisms → Bacteria → Acidobacteria	538	Open in IMG/M
3300025945\|Ga0207679_10499903	All Organisms → cellular organisms → Bacteria → Acidobacteria	1085	Open in IMG/M
3300025945\|Ga0207679_11706054	All Organisms → cellular organisms → Bacteria → Acidobacteria	576	Open in IMG/M
3300026078\|Ga0207702_12273474	Not Available	530	Open in IMG/M
3300026089\|Ga0207648_10354655	All Organisms → cellular organisms → Bacteria	1323	Open in IMG/M
3300026223\|Ga0209840_1094321	All Organisms → cellular organisms → Bacteria → Acidobacteria	648	Open in IMG/M
3300026319\|Ga0209647_1017033	All Organisms → cellular organisms → Bacteria → Acidobacteria	4617	Open in IMG/M
3300027682\|Ga0209971_1126922	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	628	Open in IMG/M
3300027907\|Ga0207428_10308848	All Organisms → cellular organisms → Bacteria → Acidobacteria	1169	Open in IMG/M
3300028380\|Ga0268265_11105369	All Organisms → cellular organisms → Bacteria → Acidobacteria	787	Open in IMG/M
3300028778\|Ga0307288_10127816	All Organisms → cellular organisms → Bacteria → Acidobacteria	944	Open in IMG/M
3300031455\|Ga0307505_10016248	All Organisms → cellular organisms → Bacteria	3535	Open in IMG/M
3300031547\|Ga0310887_10289824	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	929	Open in IMG/M
3300031562\|Ga0310886_10408829	All Organisms → cellular organisms → Bacteria → Acidobacteria	802	Open in IMG/M
3300031852\|Ga0307410_11003121	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	720	Open in IMG/M
3300032002\|Ga0307416_100810643	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300032163\|Ga0315281_11203101	All Organisms → cellular organisms → Bacteria → Acidobacteria	757	Open in IMG/M
3300033412\|Ga0310810_10003491	All Organisms → cellular organisms → Bacteria → Acidobacteria	17142	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.74%
Host-Associated	Host-Associated	33.33%
Engineered	Engineered	0.93%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.78%
Plants	Host-Associated → Plants	33.33%
Aquatic	Environmental → Aquatic	12.96%
Solid Waste	Engineered → Solid Waste	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere	24.07%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.26%
Sediment	Environmental → Aquatic → Sediment	8.33%
Freshwater	Environmental → Aquatic → Freshwater	4.63%
Grass	Engineered → Solid Waste → Grass	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.37%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	8.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.41%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.48%
Loam	Environmental → Terrestrial → Soil → Loam	4.63%
Ice	Environmental → Aquatic → Freshwater → Ice	2.78%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.93%
Lake	Environmental → Aquatic → Freshwater → Lake	0.93%
Composting	Engineered → Solid Waste → Grass → Composting	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	8.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.41%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.48%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	2.78%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.78%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.78%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.93%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.93%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	16.67%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	12.04%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.41%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	5.56%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	2.78%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.78%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.85%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.85%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.93%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.93%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.93%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.93%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.93%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.93%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918006	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental	Open in IMG/M
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
2199352024	Bare-fallow DEEP SOIL	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005980	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental	Open in IMG/M
3300011424	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2	Environmental	Open in IMG/M
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental	Open in IMG/M
3300012092	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012228	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012680	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)	Environmental	Open in IMG/M
3300012684	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)	Environmental	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300013765	Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015197	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015251	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019868	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1	Environmental	Open in IMG/M
3300020009	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026223	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)	Environmental	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
P1_C_00766040	2140918006	Soil	MDPQYKKMMLWLAAAFFGSIVAALIIVELVMRKYGP
4MG_00446510	2170459019	Switchgrass, Maize And Mischanthus Litter	VDPYYKKMMIAIGIALVASIVAAIIIVEIVIRKYGS
deeps_02805510	2199352024	Soil	MAIDPYYRKMMIWLTAAFIASILAAIVIVELVIRKYG
JGI10216J12902_1031127162	3300000956	Soil	VDSEYKKMMLWLTAAFIASVAAAFIIVEIVMRYYAES*
JGI10216J12902_1033987882	3300000956	Soil	VDPYYKKMMIAIGIALIGSIVAAIIIVEIVIRKYGS*
JGI10216J12902_1037495021	3300000956	Soil	MVGMDPEYKKMMLWLAAALIGSVAAAFIIVELMMRTYGRS*
JGI10216J12902_1190930503	3300000956	Soil	VSIDRDYKKIMLWLTAAFIASVVAAFIIVELVMRHYAEP*
JGI10216J12902_1255999174	3300000956	Soil	MATDPEYKKMMLWLAAAFVASVTAAFIIVEIVMRYYAD*
Ga0065715_100377911	3300005293	Miscanthus Rhizosphere	AMAVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS*
Ga0066388_1049657121	3300005332	Tropical Forest Soil	NTGIMDPYYRKMMIWLAVAFVAVVVAALIIVDVMMRKYGP*
Ga0070672_1000250624	3300005543	Miscanthus Rhizosphere	MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGSP*
Ga0068859_1002289072	3300005617	Switchgrass Rhizosphere	MDPYYKKMMLWLAAVFVASVAAALVIVELVMRKYGP*
Ga0066905_1006340682	3300005713	Tropical Forest Soil	MDPYYRKMMIWLAVALVTCVVAALIIVEIMMRTYGP*
Ga0066903_1000213434	3300005764	Tropical Forest Soil	MDPYYRKMMIWLAVALVTCVVAALIIVNIMMRTYGP*
Ga0066798_101401152	3300005980	Soil	MDPQYKKMMLWLAAAFFGSIVAALIIVELVMRKYGP*
Ga0066651_106947022	3300006031	Soil	MDPYYKKMMLWVAAAFVASIVAAVIIVELVIRHYGP*
Ga0075422_104859161	3300006196	Populus Rhizosphere	AMDPEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP*
Ga0075422_105520422	3300006196	Populus Rhizosphere	MDPQYRKMMLWLAAAFIASVAAAFIIVEIVMRYYAEP*
Ga0079222_104391923	3300006755	Agricultural Soil	MDPYYRKMMIWLAAAFIASVVAAFIIVEIVMRYFAES*
Ga0066653_107388662	3300006791	Soil	LIDPYYKKMMLWLAAAFVASILAAIVVVEIVMRKFGP*
Ga0066660_108880261	3300006800	Soil	MDQYYKKMVLWLAALFAASLAAAAIIVELVIRRYGQ*
Ga0075421_1007236422	3300006845	Populus Rhizosphere	MDPYYRKMMLWLAAAFVASIAAAIVIVEIMMRRYAG*
Ga0075420_1015362851	3300006853	Populus Rhizosphere	VCATIGVCGMDPYYRKMMLWLAAAFVASIAAAIVIVEIMMRRYAG*
Ga0075429_1013764102	3300006880	Populus Rhizosphere	MAMDPEYRKMMLWLTAAFVASVTAALIIVEIVMRYFGEP*
Ga0075429_1017153582	3300006880	Populus Rhizosphere	MDPEYKKMMLWLAAAFIACVVAAFVIVEIVMRTYAEP
Ga0079218_110415882	3300007004	Agricultural Soil	MATDPEYKKMMLWLAAAFIASVVAALIIVEIVMRYYAES*
Ga0079218_133825122	3300007004	Agricultural Soil	VVIDPYYKKMMLWLAAAFVATIVAALVIVELVIRRYGP*
Ga0075435_1016365271	3300007076	Populus Rhizosphere	MDPYYKKMMLWVAAALVATVAAALIIVELVMRRYAQ*
Ga0099791_103078672	3300007255	Vadose Zone Soil	MDPYYKKMMLWLAAAFVASIAAALVIVEIVMRRYAP*
Ga0066793_105952062	3300009029	Prmafrost Soil	MDPEYKKMMLWLAAAFFGSIVAALIIVEFVMRKYGP*
Ga0099830_108896272	3300009088	Vadose Zone Soil	MDPYYKKMMLWLAAAFVASIAAALVIVELVIRRFAP*
Ga0111539_102174972	3300009094	Populus Rhizosphere	MDPYYKKMMLWLAAAFVASIVAALIVVELVIRKYGGG*
Ga0111539_105063282	3300009094	Populus Rhizosphere	MDPYYKKMMLWLAAAFIASIVAAIIVVEIVTRKYGP*
Ga0111539_119652252	3300009094	Populus Rhizosphere	MAMDPEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP*
Ga0105243_114073632	3300009148	Miscanthus Rhizosphere	MAVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS*
Ga0111538_119542922	3300009156	Populus Rhizosphere	VIDPYYKKMMWWLAAAFVATVAAALVIVELVIRKYGP*
Ga0075423_103592222	3300009162	Populus Rhizosphere	MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGP*
Ga0105249_115315312	3300009553	Switchgrass Rhizosphere	MDPYYRKMMLWLAAAFVASIAAALIAVELVIRKYGGE*
Ga0105340_11085622	3300009610	Soil	MDPYYKKMMLWLAAAFVASIVAAFIVVELVIRKYGGG*
Ga0126307_101537512	3300009789	Serpentine Soil	MDPYYRKMMLWLAAAFVASIVAAIIIVELVIRRYGP*
Ga0126307_105720942	3300009789	Serpentine Soil	VTPVSIDRDYKKIMLWLAAAFIASVVAAFIIVELVMRHYAAP*
Ga0126384_106505532	3300010046	Tropical Forest Soil	MDPYYRKMMIWLAVALVTCVVAALIVVEIMMRTYGP*
Ga0126377_100540493	3300010362	Tropical Forest Soil	MDPYYRKMMIWLAVAFVAVVVAALIIVNVMMRKYGP*
Ga0134124_107669292	3300010397	Terrestrial Soil	MDPEYKKMMLWLAAALAGSIAAALLVVQLVIRRYGS*
Ga0137392_112393222	3300011269	Vadose Zone Soil	MDPYYKKMMLWLAAAFVASILAALVIVEVVMRRYAP*
Ga0137348_10845442	3300011398	Soil	MSIDRDYKKLMLWLAAAFIATIVAAVIIVELVMRHYAE*
Ga0137439_10767332	3300011424	Soil	MDPYYKKMMLWLAAAFVASIVAALIAVELVIRKYGGS*
Ga0137428_11131762	3300011432	Soil	MDPYYKKMMLWLAAAFVASVAAAIVIVEIVTRKYGP*
Ga0136621_10628343	3300012092	Polar Desert Sand	MDPYYKKMMLWLAAAFVATIVAALVIVELILRRYPE*
Ga0137374_100670375	3300012204	Vadose Zone Soil	MDAQYKKMMLWVAAAFIASILAALVIVELVIRKYGS*
Ga0137374_105254772	3300012204	Vadose Zone Soil	MDPYYKKMMLWLAAAFVVSVIAALIVVELVIRKYGGS*
Ga0137376_114565032	3300012208	Vadose Zone Soil	MVGMDPEYKKMMLWLAAALIGSVAAAFVIVELVMRTYGQS*
Ga0137378_117810582	3300012210	Vadose Zone Soil	MDPYYKKMMLWLAAAFVASVAAALLIVELVIRKYGS*
Ga0150985_1060554673	3300012212	Avena Fatua Rhizosphere	MDSYYKKMMIWLAVALVGTIVAALIIVQLVLRKYGP*
Ga0137459_10175842	3300012228	Soil	MSFDRDYKKLMLWLAAAFIATVVAAVIIVELVMRHYAE*
Ga0137372_108725371	3300012350	Vadose Zone Soil	MDPYYKKMMLWLAAVFVASIAAAAIIVEFVIRRFGP*
Ga0136612_100417522	3300012680	Polar Desert Sand	MDPYYRKMMLWLAAAFVASVVAALIIVEIVMRRYAP*
Ga0136614_101927242	3300012684	Polar Desert Sand	MDPYYKKMMLWLAAAFVASIAAAIVIVELVIRRYGL*
Ga0157294_100274593	3300012892	Soil	VDPYYKKMMIAIGIALVASIVAAIIIVEIVIRKYGS*
Ga0157309_101739902	3300012895	Soil	MDSYYKKMMVWLAVAFFGSIVAAIIIVEFVMRKYGPP*
Ga0157290_102001962	3300012909	Soil	VIDPYYKKMMWWLAAAFVASIAAALVIVELVMRKFGP*
Ga0157310_105684652	3300012916	Soil	VIDPYYKKMMWWLAAAFVASIVAALIAVELVIRKYGGG*
Ga0120172_10663302	3300013765	Permafrost	MDPYYKKMMLWLAAAFIASVAAAIVIVELVIRKYGP*
Ga0157380_126392662	3300014326	Switchgrass Rhizosphere	MDPYYKKMMLWLAAAFVASIVAALIVVEIVIRKYGGG*
Ga0167638_10763212	3300015197	Glacier Forefield Soil	MDREYKKMMLWLLAVFVASVVAAFVIVELVLRHWGPA*
Ga0180070_10165042	3300015251	Soil	MDPYYRKMMVWLAAAFVASVVAAFVIVELVIRRYAE*
Ga0132258_110857692	3300015371	Arabidopsis Rhizosphere	MDPYYKKMMLWLAAAFVASIVAALIAVELVIRKYGGG*
Ga0132256_1024715912	3300015372	Arabidopsis Rhizosphere	MDPYYKKMMLWLAAALFASIAAAFLVVELVIRKYGSR*
Ga0132256_1025466862	3300015372	Arabidopsis Rhizosphere	MSVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS*
Ga0190266_101283062	3300017965	Soil	MDPYYKKMMLWLAAAFIASIVAAIIVVEIVTRKYGP
Ga0184624_100243032	3300018073	Groundwater Sediment	MDPYYKKMMLWVAAAFVASIVAAVIIVELVIRHYGP
Ga0184629_102131282	3300018084	Groundwater Sediment	MDPYYKKMMLWLAAAFVASIAAALVIVEIVMKRYAP
Ga0190272_131626922	3300018429	Soil	MDPYYKKMMLWVAAAFVASIVAALIIVELVIRKYGP
Ga0190275_103734382	3300018432	Soil	MSIDRDYKKIMWWLAAAFIATVIAAFIIVELIMRHYAPE
Ga0190275_124801671	3300018432	Soil	MDPYYKKMMLWLAAAFIATILAALVIVELVLRRYPEQ
Ga0190270_100269632	3300018469	Soil	MSIDRDYKKLMLWLAAAFIATVVAAVIIVELVMRHYGE
Ga0190274_137072451	3300018476	Soil	VIDPYYKKMMWWLAAAFVASIAAALVIVELVMRKFGP
Ga0190271_104198002	3300018481	Soil	VIDPYYKKMMWWLAAAFVASIAAALVIVELVIRKFGP
Ga0190271_111745522	3300018481	Soil	DPYYKKMMWWLAAAFVASIAAAIVIVELVIRRYGP
Ga0173482_101466742	3300019361	Soil	MDSYYKKMMVWLAVAFFGSIVAAIIIVEFVMRKYGPP
Ga0193720_10134252	3300019868	Soil	MDREYKKMMLWLAAALFGSVAAAFIIVEFMMRKYGQG
Ga0193740_10189273	3300020009	Soil	MSIDRDYKKLMLWLAAAFIASVVAAVIIVELVMRHYAEP
Ga0210380_103318772	3300021082	Groundwater Sediment	MDPYYKKMMLWVAAAFVASIVAAVIIVELVIRKYGGG
Ga0222622_101573942	3300022756	Groundwater Sediment	MDPYYKKMMLWLAAVFVASVVAALAIVELVMRQYGP
Ga0207697_100162843	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGSP
Ga0207656_102913542	3300025321	Corn Rhizosphere	MDSYYKKMMVWLAIAFFGSIVAALIIVEFVMRKYGS
Ga0207682_100948612	3300025893	Miscanthus Rhizosphere	MAVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS
Ga0207685_101588743	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MDSYYKKMMVWLAIAFIGSIVAALVIVELVMRKYGP
Ga0207684_106680172	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MDPYYKKMMLWLAAVFVASVAAALVIVELVMRKYGP
Ga0207681_112240582	3300025923	Switchgrass Rhizosphere	MDPYYKKMMLWLAAAFVASIVAALIAVELVIRKYGGG
Ga0207669_117078052	3300025937	Miscanthus Rhizosphere	MDPYYKKMMLWLAAAFVASIVAAVIIVELVIRKYGP
Ga0207679_104999032	3300025945	Corn Rhizosphere	MDPYYKKMMLWPAAVFVASVAAALVIVELVMRKYGP
Ga0207679_117060542	3300025945	Corn Rhizosphere	HTRMDPEYKKMMLWLAAALAGSIAAALLVVQLVIRRYGS
Ga0207702_122734742	3300026078	Corn Rhizosphere	MDPYYKKMMLWLAAVLFASIGAAFILVEYVIRKYGS
Ga0207648_103546553	3300026089	Miscanthus Rhizosphere	MDPYYKKMMLWLAAAFVATIVAALIIVELVMRRYAQ
Ga0209840_10943212	3300026223	Soil	GLKAGHGRSMDPQYKKMMLWLAAAFFGSIVAALIIVELVMRKYGP
Ga0209647_10170332	3300026319	Grasslands Soil	MDPYYKKMMLWLAAVFVASIVAALVVVEIVIRRYAP
Ga0209971_11269222	3300027682	Arabidopsis Thaliana Rhizosphere	MSVDPYYKKMMIWLGVALVASIVAAIIIVEVVIRKYGS
Ga0207428_103088482	3300027907	Populus Rhizosphere	MDPYYKKMMLWLAAAFVASIVAALIVVELVIRKYGGG
Ga0268265_111053692	3300028380	Switchgrass Rhizosphere	MDPYYRKMMLWLAAAFVASIAAALIAVELVIRKYGGE
Ga0307288_101278162	3300028778	Soil	LIDPYYKKMMLWLAAAFVASVAAAILIVELVMRKFGP
Ga0307505_100162483	3300031455	Soil	MIDPYYKKMMLWLAAAFVATIIAALVIVELVLRRYPE
Ga0310887_102898242	3300031547	Soil	MAMDPEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP
Ga0310886_104088292	3300031562	Soil	PEYRKMMLWLTAAFVASVTAAFIIVEIVMRYFGEP
Ga0307410_110031211	3300031852	Rhizosphere	MAMDPEYKKMMLWLTAAFIASVAAAFIIVEIVMRYYAES
Ga0307416_1008106432	3300032002	Rhizosphere	MDPYYKKMMIWLGVAFVASIVAAIIIVEIIVRRYGP
Ga0315281_112031012	3300032163	Sediment	MDPYYKKMMLWLAAAFVASVAAAIVIVELVIRRYGP
Ga0310810_1000349113	3300033412	Soil	MDPYYKKMMLWLAAALFASIAAAFLVVELVIRKYGSR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F090585

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign